SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000030563 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000030563
Domain Number 1 Region: 363-420
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.75e-26
Family Classic zinc finger, C2H2 0.0036
Further Details:      
 
Domain Number 2 Region: 699-756
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.39e-26
Family Classic zinc finger, C2H2 0.0044
Further Details:      
 
Domain Number 3 Region: 531-588
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.54e-25
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 
Domain Number 4 Region: 587-644
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.24e-24
Family Classic zinc finger, C2H2 0.0057
Further Details:      
 
Domain Number 5 Region: 307-364
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.93e-24
Family Classic zinc finger, C2H2 0.0037
Further Details:      
 
Domain Number 6 Region: 755-812
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.49e-23
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 7 Region: 9-69
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 6.02e-22
Family KRAB domain (Kruppel-associated box) 0.00087
Further Details:      
 
Domain Number 8 Region: 419-476
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.23e-21
Family Classic zinc finger, C2H2 0.0048
Further Details:      
 
Domain Number 9 Region: 475-532
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.51e-21
Family Classic zinc finger, C2H2 0.0056
Further Details:      
 
Domain Number 10 Region: 643-700
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.23e-21
Family Classic zinc finger, C2H2 0.0088
Further Details:      
 
Domain Number 11 Region: 269-321
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.18e-19
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 12 Region: 797-849
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.46e-19
Family Classic zinc finger, C2H2 0.0071
Further Details:      
 
Domain Number 13 Region: 204-255
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000741
Family Classic zinc finger, C2H2 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000030563   Gene: ENSMODG00000023586   Transcript: ENSMODT00000032134
Sequence length 863
Comment pep:novel chromosome:BROADO5:4:402999926:403026680:-1 gene:ENSMODG00000023586 transcript:ENSMODT00000032134 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAGTQSAPSREWMTFKDVAVDFTREEWRLLDHSQKELYREVMLENVQNLLSVGLPVPRE
DLISSFLQGEAPWLLEPKSPRSSCPGAETRFQVNELSTKLSIFADESGQEKFMSDFSLRE
TCDSDINVDENPKSDCEFDETRKTFKQCSGLNHDKKINSGNDSFQDMEDSKCSTEQIELF
QSHEKPPEMYMYQGNLQEKSSQGSSDLIRYQKKFTGKMLHKNNKGGMAFSQNSKLITHQK
IHTRKESSGHNECGATSLPYRPRFHTRKKAYACNQCGKAFAWNSDLIRHQKIHTGEKSYK
CNDCGKAFSFRSLLISHQRIHTGEKPFGCNQCGKVFSQKASLVLHQRIHTGERPYKCNQC
EKAFRKSSSLGKHQRIHTGEKPYECNQCGKAFSQSSNLVAHQRIHTGEKPFQCNRCGKAF
RYSSSLVSHERFHTGEKPFGCNHCGKAFQCNSHLVEHQRTHTGEKPYKCKQCVKAFTKHS
SLIKHQRIHTGKKHFECKQCGKVFRCHSRLIDHEKIHTGEKPYKCNQCGKAFTQSSNLAV
HQRTHTGETPFECQQCEKSFRYSSSLAKHQRIHTGEKPYKCNHCGKTFRINSSLSAHQRI
HTGEKPYKCNQCGKAFRISSSLGKHQRIHTGEKIFECNQCGKVFTQNSHFATHQRIHTGE
KPYECKECGKAFRSSASLTDHEKIHNKEKLYECNHCRKVFTKSSTLIVHQRIHTGEKPYE
CKQCGKAFTQKNHLAVHQRIHTGEKPYKCNQCEKAFTISCSLAKHQRIHTGEKPYECDQC
GKAFTQKANFAKHQRVHTGEKPFECNQCTMAFTKISALTAHQRIHTGEKPYECKQCGKGF
TKSYSLAAHGRIHTVGKPRGGHE
Download sequence
Identical sequences F7BPJ1
ENSMODP00000030563 ENSMODP00000030563

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]