SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000030581 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000030581
Domain Number 1 Region: 463-520
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.04e-26
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 2 Region: 547-604
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.82e-26
Family Classic zinc finger, C2H2 0.0052
Further Details:      
 
Domain Number 3 Region: 659-716
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.2e-26
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 4 Region: 379-436
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.43e-24
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 5 Region: 603-660
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2e-24
Family Classic zinc finger, C2H2 0.0073
Further Details:      
 
Domain Number 6 Region: 701-753
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.32e-21
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 7 Region: 80-136
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 4.32e-20
Family KRAB domain (Kruppel-associated box) 0.00081
Further Details:      
 
Domain Number 8 Region: 743-790
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.76e-18
Family Classic zinc finger, C2H2 0.0057
Further Details:      
 
Domain Number 9 Region: 326-380
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.08e-16
Family Classic zinc finger, C2H2 0.007
Further Details:      
 
Domain Number 10 Region: 426-458
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000811
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 11 Region: 510-542
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000146
Family Classic zinc finger, C2H2 0.0091
Further Details:      
 
Domain Number 12 Region: 267-319
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000134
Family Classic zinc finger, C2H2 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000030581   Gene: ENSMODG00000023590   Transcript: ENSMODT00000032152
Sequence length 791
Comment pep:novel chromosome:BROADO5:4:403044436:403059974:-1 gene:ENSMODG00000023590 transcript:ENSMODT00000032152 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMCVNPCPTTPYFNPPRSLFLLETIPAHASPRPASHLRREDKDKVSLLCDPLPPSTQTVE
DQCLEPERMAPGTPRFLALERVTFQDVAVDFTEEEWRLLGHSQKELYKEVMLENVQNLLS
VGLPVAREDMIYFQEGETPWILEQKGPRNSHPVAVTSFEMNETTTNLNISMEDSCQPTSM
SDGPYDFILREICDSDKNPRNPCQFNEMEKNLTQYSALNHCKKITSRNDCSQYSKYRECF
TEQVELIQSHENPPELQEYQDNQWEMTFSLNSDLNRPQKSFPGKKLSICNEGKKTFSQDS
KIIRHQKFRTQKKPYECNEGAATVNHYSTLPYHPKFPPGMKIYACTQCGKTFHWNSDLVR
HQKIHAEDKPYKCNECGKSFCYRSLLIGHQRIHTGEKPYECNECGKAFCYRSLLVGHQRI
HTGEKPYKCSQCGKAFQSSSRLTSHQRIHTGEKPYECNQCGKAFTQSSHLVTHQRIHTGE
KPYECNQCGKAFRFRSGLASHQRIHTGEKPYECNQCGKAFQSSSRLACHQRIHTGEKPYE
CNQCGKAFTQSSHLGIHQRIHTGEKPYECNQCGKAFRFRSGLATHQRIHTGEKPYECNQC
GKAFQCSSSLAKHQRIHTGERPYECNQCGKAFRCSSSLAAHQRIHTVEKPYECSQCGKAF
IKSSSLAIHQRIHTGEKPYKCNQCGKSFQYHSHLVVHLRIHTGEKPYECNQCGKAFQSSS
SLATHQRIHTGERPYECNHCGKAFQCNSNLAAHQRIHTGEKPYECKQCGKAFRYLSGLAV
HQRIHIGEKPS
Download sequence
Identical sequences F7BNF9
ENSMODP00000030581 ENSMODP00000030581

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]