SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000030598 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000030598
Domain Number 1 Region: 250-307
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.02e-26
Family Classic zinc finger, C2H2 0.0048
Further Details:      
 
Domain Number 2 Region: 138-195
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.73e-26
Family Classic zinc finger, C2H2 0.0033
Further Details:      
 
Domain Number 3 Region: 26-83
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.27e-24
Family Classic zinc finger, C2H2 0.0031
Further Details:      
 
Domain Number 4 Region: 194-251
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.41e-24
Family Classic zinc finger, C2H2 0.0035
Further Details:      
 
Domain Number 5 Region: 82-139
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.21e-22
Family Classic zinc finger, C2H2 0.0083
Further Details:      
 
Domain Number 6 Region: 292-344
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.27e-18
Family Classic zinc finger, C2H2 0.0045
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000030598
Domain Number - Region: 6-21
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00357
Family Classic zinc finger, C2H2 0.0089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000030598   Gene: ENSMODG00000029292   Transcript: ENSMODT00000010870
Sequence length 357
Comment pep:novel chromosome:BROADO5:2:251694342:251695415:1 gene:ENSMODG00000029292 transcript:ENSMODT00000010870 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SEYTSYLHQRIHTGEKPYECNECGKTFSQSAHFTQHQRIHTGEKPYECNECGKAFSYCSD
LIQHQKIHTGEKPYKCNICSNAFNACSALIQHQRTHTGEKPYECNRYWKAFSNYSALIRH
HVVHTGEKPYECSECGKAFSRSTYLTQHQRVHTGEKPFECNECGKVFSQSAFLTQHQRIH
TGEKPYTCNECGKAFSDRSGHIQHQRTHTGEKPYSCNECGKAFSYCSALIQHKRIHTGEK
PYACNDCGKAFSDRSALIQHQRTHTGEKPYKCNVCGKAFSQSTNLTNHQKTHTGEKPYKC
NECSKAFGYCSGLIQHQIIHTGEKPYECSEYGKAFCRTIDLTKHQKIHSGGETLYMQ
Download sequence
Identical sequences F7B1G7
ENSMODP00000030598 ENSMODP00000030598

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]