SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000030629 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000030629
Domain Number 1 Region: 369-426
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.17e-24
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 2 Region: 481-538
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.48e-24
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 3 Region: 258-314
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.07e-23
Family Classic zinc finger, C2H2 0.0056
Further Details:      
 
Domain Number 4 Region: 201-258
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.22e-23
Family Classic zinc finger, C2H2 0.0053
Further Details:      
 
Domain Number 5 Region: 145-202
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.33e-23
Family Classic zinc finger, C2H2 0.0078
Further Details:      
 
Domain Number 6 Region: 426-482
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.95e-23
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 7 Region: 9-69
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 8.76e-23
Family KRAB domain (Kruppel-associated box) 0.00085
Further Details:      
 
Domain Number 8 Region: 583-635
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.46e-18
Family Classic zinc finger, C2H2 0.0027
Further Details:      
 
Domain Number 9 Region: 537-594
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.55e-18
Family Classic zinc finger, C2H2 0.014
Further Details:      
 
Domain Number 10 Region: 90-146
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.49e-18
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 11 Region: 313-370
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.82e-17
Family Classic zinc finger, C2H2 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000030629   Gene: ENSMODG00000023595   Transcript: ENSMODT00000032199
Sequence length 640
Comment pep:novel chromosome:BROADO5:3:503895428:503959581:-1 gene:ENSMODG00000023595 transcript:ENSMODT00000032199 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPGTPRPPSQGLITFKDVAVDFTQEEWCLLDHSQKELYLEVMLENVQNLLSVGLPVTRE
HLISCFQQGKTPWLPEQKGPKSSSPGGRCFSQKTKLVAYQRIHTGEKPYEYKHCGKPFTE
RCSLFQHERIHTGVKLHECQHCGKSFRQRSNLISHQNIHTGVKPHECQHCGKSFTERSNL
ITHYRIHTGEKPYECKHCGKAFIERGSLVKHQRIHTGSKPYECKHCGKAFTHRSSLVAHQ
RIHTGEKPYECEHCGKPFRQRGHLIAHQSIHTGEKAYKCLHCGKSFSRKSNLIAHQRIHT
GEKPYECKNCGKAFKRKESFAKHQSIHTGEISYECKNCGESFKEKGSLAKHQSIHNGGKR
YECKHCGKAFIHRSSLIFHQRIHTGEKPYECKYCGKYFRNRSNLTSHQRIHTGEKPYECQ
HCGKYFRNRSNLISHQSIHTGEKPYECKQCGRAFTKKGYLTKHQRIHTGRKPYECKQCGK
AFTERSSLATHQRIHTGEKPYECEKCGKAFTCRSLLAAHQRIHTGEKPYECLHCGKAFRL
KGQLIAHHNIHTREKSYECKQCGRAFTKKGYLTKHQRIHIERKIYECKQCGKAFTCRSHL
ATHHRIHTGEKPYECKQCGNAFTQRGHLIVHQRIHTGEKP
Download sequence
Identical sequences F7G0L1
ENSMODP00000030629 ENSMODP00000030629

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]