SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000030635 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000030635
Domain Number 1 Region: 390-447
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7e-26
Family Classic zinc finger, C2H2 0.0035
Further Details:      
 
Domain Number 2 Region: 138-195
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.35e-26
Family Classic zinc finger, C2H2 0.0034
Further Details:      
 
Domain Number 3 Region: 194-251
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.19e-24
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 4 Region: 306-363
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.38e-24
Family Classic zinc finger, C2H2 0.0053
Further Details:      
 
Domain Number 5 Region: 250-307
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.9e-22
Family Classic zinc finger, C2H2 0.0075
Further Details:      
 
Domain Number 6 Region: 83-139
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.59e-20
Family Classic zinc finger, C2H2 0.0053
Further Details:      
 
Domain Number 7 Region: 2-45
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 9.81e-18
Family KRAB domain (Kruppel-associated box) 0.0011
Further Details:      
 
Domain Number 8 Region: 353-385
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000205
Family Classic zinc finger, C2H2 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000030635   Gene: ENSMODG00000023596   Transcript: ENSMODT00000032205
Sequence length 447
Comment pep:novel chromosome:BROADO5:3:503829412:503839676:1 gene:ENSMODG00000023596 transcript:ENSMODT00000032205 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GSITFKDVAVDFSQEEWCQLDHSQKELYLEVMLENVQNLLSVAFVNNLKRKSSGLCPGMS
LSLHPKSKHVKMASVNDKGGRPFNTNSELAAYQRIHTREKLYECKHCGKAFTWKVSFAKH
QTIHTGEKPFECKKCGKAFIRRSYLVAHQSIHTGEKPYECKQCGKAFIRRSYLVAHQRIH
TGEKPYECKQCGKAFTVRTNLARHQRIHTGEKPYECKHCRKAFTWKVSLAKHQRIHTGEK
PYECKHCGKAFSERGHLAKHQRIHNGGKPYECKQCGKAFIRRSHLTTHQNIHTREKPYEC
KHCGKSFTQRGHLSAHQRIHTGEKPYECKQCGKTFTVRSNLARHHTIHTGEKPYECKHCG
KAFTWKVSLAVHQSIHTGEKPYVCQHCGKAFTRRDSLAKHQRIHTGEKPYECKQCGKVFI
RMSYLTTHQRIHTGEKPYECKQCGKAF
Download sequence
Identical sequences F7FQ88
ENSMODP00000030635 ENSMODP00000030635 13616.ENSMODP00000030635

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]