SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000030640 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000030640
Domain Number 1 Region: 326-383
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.93e-25
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 2 Region: 466-523
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.06e-24
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 3 Region: 242-299
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.87e-23
Family Classic zinc finger, C2H2 0.007
Further Details:      
 
Domain Number 4 Region: 522-579
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.94e-23
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 5 Region: 9-69
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 6.54e-23
Family KRAB domain (Kruppel-associated box) 0.00096
Further Details:      
 
Domain Number 6 Region: 634-692
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.88e-23
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 7 Region: 410-467
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.44e-23
Family Classic zinc finger, C2H2 0.0038
Further Details:      
 
Domain Number 8 Region: 159-215
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.64e-22
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 9 Region: 578-635
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.34e-21
Family Classic zinc finger, C2H2 0.008
Further Details:      
 
Domain Number 10 Region: 677-729
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.96e-21
Family Classic zinc finger, C2H2 0.0048
Further Details:      
 
Domain Number 11 Region: 373-405
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000276
Family Classic zinc finger, C2H2 0.0071
Further Details:      
 
Domain Number 12 Region: 289-321
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000254
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 13 Region: 205-237
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000694
Family Classic zinc finger, C2H2 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000030640   Gene: ENSMODG00000023597   Transcript: ENSMODT00000032210
Sequence length 737
Comment pep:novel chromosome:BROADO5:3:503791221:503993350:-1 gene:ENSMODG00000023597 transcript:ENSMODT00000032210 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTPGTPRSPSQGPITFKDVAVDFSQEEWCLLDHSQKELYLEVMLENVQNLLSVGLPVPRE
NFISCFQQGKASWLLEQKDPRNSCPGELSNTVNKACSEYNKCFPDEEGNVLFPEKHPEMS
MYQGNLEGLACGWSLDLNRHNKSKCVLMVSVSDKGRKPFSQNSEFAAHERIHTEEKPYEC
QHCGKAFTKRSNLAKHQKIHTGEKPHECQHCGKAFTQRRSLAAHQSIHTGQKPYECKQCG
KAFTWKVSLDTHQRIHTGEKLYECKQCGKTFTWKFSFVAHQRIHAGEKPYECTQCGKVFT
QRRSLAAHKTVHTGEKPYECKHCGKAFTWKISLDTHQRIHTGEKPYECKQCGKAFTWKFS
LATHQRIHTGEKPYKCKHCGKAFTDRGSLVKHQRIHTGEKPYECTHCRVAFNVKSHLAAH
ERIHTGEKPYECKQCGKAFIRRSYLTKHQRNHTGEKPYECTHCRVAFAMKSHLAAHERIH
TGEKSYKCKQCGKAFIRRNYLVKHQRIHSGEKPYECKQCGKAFRERGSLTKHQRIHTGEK
PYECTQCGKAFTQKRSLAAHKIVHTGDKPYECKHCGKAFPWKVSLSRHQRIHSQEKSYKC
KQCGKIFTERDSLDKHQSIHTREKPYKCKQCGKAFIERGSLAKHQRIHTGEKPYECTQCG
KAFPWKVSLCKHQRRIHTGETPYECKHCGKAFTQRSHLTTHQRIHTGEKPYECKQCGKAF
TQWGSLSKHQRIHTGEK
Download sequence
Identical sequences F7FPW9
ENSMODP00000030640 ENSMODP00000030640

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]