SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000030644 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000030644
Domain Number 1 Region: 373-430
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.57e-24
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 2 Region: 513-570
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.82e-24
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 3 Region: 317-374
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.49e-24
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 
Domain Number 4 Region: 429-486
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2e-23
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 5 Region: 569-626
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.21e-23
Family Classic zinc finger, C2H2 0.0056
Further Details:      
 
Domain Number 6 Region: 10-71
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.09e-22
Family KRAB domain (Kruppel-associated box) 0.00087
Further Details:      
 
Domain Number 7 Region: 234-290
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.29e-22
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 8 Region: 653-710
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.18e-22
Family Classic zinc finger, C2H2 0.0045
Further Details:      
 
Domain Number 9 Region: 709-762
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000105
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number 10 Region: 476-508
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000348
Family Classic zinc finger, C2H2 0.0076
Further Details:      
 
Domain Number 11 Region: 280-312
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000632
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 12 Region: 616-648
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000101
Family Classic zinc finger, C2H2 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000030644   Gene: ENSMODG00000023599   Transcript: ENSMODT00000032214
Sequence length 784
Comment pep:novel chromosome:BROADO5:3:503616740:503774102:1 gene:ENSMODG00000023599 transcript:ENSMODT00000032214 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTAVLLALTIFKGSITFKDVAVDFTQEEWCLLDHSQKELYLEVMLENVQNLLSVGLPVPR
ENFISCFQQGESSWLLEQKGLRHSCPEAETNFEVKEMTTKLSLIVEGSGPQKCMSEGLYD
FIVREISDSTIKANKNLKIDCKFDETTEKFNQYSVLKQYMKLTSENDCCQDSEYRKCFPE
ELGLVQLNEKPPEKPICKGNLGRMAFGWSLDHIRHPKSKHVTMVSVSDKGGRPFSQNSEF
AAHQRNHTREKPYECKHCGKAFKRRGHLVAHQTIHTGEKPYECKHCGKAFTERGNLAAHQ
RIHSGEKPYECKHCGKVFTQRGHLAAHQTVHTGEKPYECKQCGKAFTWRGSLTRHQTIHS
GEKPYECKHCGKAFTQRDHLTTHQRIHTGEKPYECKHCGKAFTQKGYLASHQRIHSGEKP
YECKHCGKAFTQKGYLAAHQRIHSGEKPYKCKHCGKVFTWRDSLVAHQTVHSGEKPYKCK
HCGKAFTQRGYLAAHQRIHSGEKPYKCKHCGKAFTWRDSLVSHQRIHSGDKPYECKHCGK
TFTQRGYLASHQRIHTGEKPYECKQCGKAFTGRGNLAAHQTVHSGEKPYECKHCGKAFTQ
RGNLAAHQRIHSGEKPYECKHCGKTFTWRDSFVAHQRIHSGETPYECKHCGKAFIWKISL
AKHERIHSGEKPYECKQCGKAFTQRDDFAAHERIHTGEKADECKQCGKTFPWRGSLARHQ
VVDTREKLYECKQCGETFRGRTHLTTHQRIHSGEKLYECKHWKDFHTNGQSCCTSDSPRR
RETL
Download sequence
Identical sequences F7FPT7
ENSMODP00000030644 ENSMODP00000030644

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]