SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000030659 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000030659
Domain Number 1 Region: 41-133
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 1.05e-39
Family SCAN domain 0.0000405
Further Details:      
 
Domain Number 2 Region: 387-444
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.97e-27
Family Classic zinc finger, C2H2 0.0026
Further Details:      
 
Domain Number 3 Region: 331-388
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.15e-26
Family Classic zinc finger, C2H2 0.0024
Further Details:      
 
Domain Number 4 Region: 429-481
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.46e-21
Family Classic zinc finger, C2H2 0.0034
Further Details:      
 
Domain Number 5 Region: 293-345
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.32e-16
Family Classic zinc finger, C2H2 0.0052
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000030659
Domain Number - Region: 260-304
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0506
Family Classic zinc finger, C2H2 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000030659   Gene: ENSMODG00000008247   Transcript: ENSMODT00000032229
Sequence length 488
Comment pep:known_by_projection chromosome:BROADO5:2:253220159:253228106:1 gene:ENSMODG00000008247 transcript:ENSMODT00000032229 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSEYSRTFPLQEQEGLCTVKVEDEEDNAWEQESCIQGNNSPRQEIFRQRFRQFAYHYTP
GPREALSRLRELCHQWLRPEMHTKEQILELLVLEQFLTILPEELQTWVQERCPGSGEEAV
TVLEDLEKELDEPGQQVQNHEHEQGVVWNEMTPLRTSKQSWNIQPIETQLKCESKEPYHL
QNGYQSENKKKCPAYKQKISEVESLRATSEKPQKCTTQGLDYKKVYGCEDTLEKHSRSPI
GERLNGSDLQEQDFMQVTVTHSIIPPVKRDFEQKECERSCSVGSAHVIHQRERLHRCDTC
GQTFKQNSALIQHQRIHNGRKSYDCLECGKAFRWSSHLVQHQRIHTGEKPYGCNECGKAF
RGSSDLIQHRRIHTGEKPYECNECGKAFSQSSKLIRHQRIHSGEKPYECNECGKSFSQIS
VLIRHQRIHTGENPYACNECGKAFNQSSALTQHQRIHTGEKPYECNECRKTFRHRSGLIQ
HQRIHTRK
Download sequence
Identical sequences F7FBB7
ENSMODP00000030659 ENSMODP00000030659

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]