SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000030661 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000030661
Domain Number 1 Region: 334-391
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.88e-25
Family Classic zinc finger, C2H2 0.0051
Further Details:      
 
Domain Number 2 Region: 503-559
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.06e-24
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 3 Region: 446-503
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.41e-22
Family Classic zinc finger, C2H2 0.0045
Further Details:      
 
Domain Number 4 Region: 15-70
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 5.62e-22
Family KRAB domain (Kruppel-associated box) 0.0011
Further Details:      
 
Domain Number 5 Region: 549-600
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.73e-20
Family Classic zinc finger, C2H2 0.0045
Further Details:      
 
Domain Number 6 Region: 390-447
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.6e-19
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 7 Region: 296-348
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.89e-18
Family Classic zinc finger, C2H2 0.0071
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000030661
Domain Number - Region: 586-631
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00019
Family Classic zinc finger, C2H2 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000030661   Gene: ENSMODG00000023601   Transcript: ENSMODT00000032231
Sequence length 635
Comment pep:novel chromosome:BROADO5:3:503602861:503609809:1 gene:ENSMODG00000023601 transcript:ENSMODT00000032231 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEECGEGTGLEPCRPPQASVTFKDVAVDFTWEEWRLLDPPQKELFWEVMLENYRNLVCLG
LADSNKDVMISELESGEPHWIPTGGVLRSCWPDWDTRPQTKELASKMSISMKVLSQEKFL
ENNPSVCKIEKIWECDSRLKKKQNIQGKPSRGIKIIQAEPPSEARVSEYNKYYHSSTEPD
LFPQQGVAIVTQCQKGDNQRGSSTMNSNQGQCNQIYSRKKCFRVNKCQKVLGHDLGYIKK
HAIHSEENIHERGNSFLRNNELSPHQTTDRGKPCNDLSKRRNTSRAEHSHLQSTERRYNC
SECGKAFQQKGALKAHCRIHTGEKPFKCSECGRAFCQKTDLIRHFRIHTGEKPFKCSDCG
KAFSRSTNLTLHQRSHTGEKPYACNECGKTFRSSSHLSEHRRTHEGTGLHECNVCGKTFS
RKYDFTNHSRIHTREKPYECSECGKAFRLKSSLTFHFRNHTGEKPFKCSECGKAFYRKQD
LINHNRIHTGEQPFQCNLCGKGFPWRRSLTQHQRIHTGEQPFQCNVCGKVFPWRNSLTRH
QRIHTGEQPFQCNICGKGFPWRNSLTRHQRIHTGEKPYKCKYCGKAFPRSSAVTRHQKIH
TESYECNESGKASFQNKNLSLCEKKIHIKKKILGM
Download sequence
Identical sequences F7FB44
ENSMODP00000030661 ENSMODP00000030661 XP_007490338.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]