SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000030676 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000030676
Domain Number 1 Region: 422-479
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.83e-24
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 2 Region: 478-535
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.24e-24
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 3 Region: 254-311
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.9e-24
Family Classic zinc finger, C2H2 0.0057
Further Details:      
 
Domain Number 4 Region: 618-675
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.96e-24
Family Classic zinc finger, C2H2 0.0053
Further Details:      
 
Domain Number 5 Region: 366-423
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.66e-23
Family Classic zinc finger, C2H2 0.0052
Further Details:      
 
Domain Number 6 Region: 674-731
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.03e-22
Family Classic zinc finger, C2H2 0.0098
Further Details:      
 
Domain Number 7 Region: 311-367
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.65e-22
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 8 Region: 534-591
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.38e-21
Family Classic zinc finger, C2H2 0.0086
Further Details:      
 
Domain Number 9 Region: 201-255
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.02e-17
Family Classic zinc finger, C2H2 0.0075
Further Details:      
 
Domain Number 10 Region: 581-613
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000111
Family Classic zinc finger, C2H2 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000030676   Gene: ENSMODG00000023610   Transcript: ENSMODT00000032245
Sequence length 738
Comment pep:novel chromosome:BROADO5:3:503483634:503497754:-1 gene:ENSMODG00000023610 transcript:ENSMODT00000032245 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWLWTSPRKSGVYWTILRKSCTWRSCWRMYKIYSLWQGKAPWLLEQKGPRSSSPAVNFEA
KVMCTKLSPFVDGSGPQRCTNEDPHDFIWREICDSTIKVNKNPKSDCEIDETAEKFSQYS
VLTQYTKLTSGNDCCQDGKYRKCFPEEVRFVQSPNKPEMPMYQGKVGGMAFGWSLDFIRH
PKSKPINMVSVNNKGGGPLSQESKLVAHHRIHTREKPYECKQYRKDFTERGSFVKHQIIH
MGEKPYKCQHCGKAFAQRDSLVKHERIHTGEKPYECQHCGKAFRQRGHLTAHQRIHSGEK
PYKCEYCGKHFRQRGRLVAHQSIHTSGKPYECKQCGKAFIEKGSLAKHQRIHTGEKPYEC
QHCGKAFRERGNLNDHQRIHTGEKPYECQHCGKAFRQRGRLVAHQRIHSGEKPHECQQCG
KAFTEKGSLTAHQRIHTGEKPYECQHCGKAFTERGSLYAHQRIHTGEKPYECQHCGKAFA
QRDSLVTHERIHTGEKPYECQHCGKAFAYRDSLVKHERIHTGEKPYECQHCGKAFGQRGN
LTAHQRIHSGEKPYKCQHCGKHFRQRGRLVAHQSIHTSGKPYECKQCGKAFIEKGSLAKH
QSIHTGEKPYECQHCGKTFRQRHNLTAHQRIHSGEKPHECQQCGKAFTEKGSLTAHQRVH
TGEKPYECQHCGKAFAHRQNLTAHQIIHSGEKPYKCEYCGKHFRWRGRLVAHQSIHTSEK
PYECKQCGKAFIEKGSLC
Download sequence
Identical sequences F7EXI7
ENSMODP00000030676 ENSMODP00000030676

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]