SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000030705 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000030705
Domain Number 1 Region: 97-154
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.61e-25
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 2 Region: 265-322
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.62e-25
Family Classic zinc finger, C2H2 0.0058
Further Details:      
 
Domain Number 3 Region: 321-378
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.12e-23
Family Classic zinc finger, C2H2 0.007
Further Details:      
 
Domain Number 4 Region: 41-98
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.22e-23
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 5 Region: 153-210
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.42e-23
Family Classic zinc finger, C2H2 0.0072
Further Details:      
 
Domain Number 6 Region: 437-494
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.95e-23
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 7 Region: 209-266
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.06e-22
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 8 Region: 548-605
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.4e-22
Family Classic zinc finger, C2H2 0.0093
Further Details:      
 
Domain Number 9 Region: 377-438
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.18e-20
Family Classic zinc finger, C2H2 0.0044
Further Details:      
 
Domain Number 10 Region: 604-654
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.33e-20
Family Classic zinc finger, C2H2 0.0083
Further Details:      
 
Domain Number 11 Region: 493-549
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.4e-19
Family Classic zinc finger, C2H2 0.0056
Further Details:      
 
Domain Number 12 Region: 6-55
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000045
Family Classic zinc finger, C2H2 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000030705   Gene: ENSMODG00000006378   Transcript: ENSMODT00000032275
Sequence length 654
Comment pep:novel chromosome:BROADO5:4:397886891:397927955:1 gene:ENSMODG00000006378 transcript:ENSMODT00000032275 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IYTEEKLHEYHECGKVFSVHFSLIKHQTIHSGEKSYVYKKTFRDRSTLNKHQRIHTGEKY
YECSECRKTFRDRSNLYKHQRIHTGKKPYECNECGKAFTQRGNLAVHKRIHTGEKPYECN
QCGKAFTCSSSLAVHKRIHTGEKPYECHECGKVFREYYFLNVHQRIHTEEKPYKCNQCGK
AYKRRYSLTLHLAIHTGEKPYECDQCGKAFTRRAHLTGYQKIHTGEKPHECLECGKAFSC
SSYLAIHKRIHTGEKPFECNQCGKAFRCSSSLVEHQRIHTGEKLYECKQCGKAFRCSSTL
AEHQRIHTGEKPYKCNQCGKAFRCFSSLAVHNRIHTGEKPFECNQCGKSFKCRSSPAAHQ
RIHTGEKPYECKQCGKAFINKSKLVRHQRIHTGEKPYDEAFKCNHCEKAFHCSSGLVTHE
RVHIGEKPYECNQCGKSFARLSTLCKHQSIHTGEKPYECKQCGKAFSCNSCLAVHRRIHT
GEKPYQCGQCGKAFRCPSNLRNHQKIHSAEKLYECSQCGKAFRWRSNLNKHQTTHIGEKP
YECQCGKAFRCSSNLIEHQRIHTGEKLHECHQCEKTFINKYYLAEHERSHTGEKPYECSQ
CGKAFAQRNSLAVHKRIHTGERPYECNQCGKTFRCSYSLKIHKRIHTGEKPYEC
Download sequence
Identical sequences F7BMD7
ENSMODP00000030705 ENSMODP00000030705

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]