SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000030710 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000030710
Domain Number 1 Region: 318-375
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.08e-26
Family Classic zinc finger, C2H2 0.0033
Further Details:      
 
Domain Number 2 Region: 262-319
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.14e-25
Family Classic zinc finger, C2H2 0.0048
Further Details:      
 
Domain Number 3 Region: 50-108
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 6.8e-25
Family KRAB domain (Kruppel-associated box) 0.001
Further Details:      
 
Domain Number 4 Region: 458-515
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.92e-25
Family Classic zinc finger, C2H2 0.0035
Further Details:      
 
Domain Number 5 Region: 375-431
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.51e-23
Family Classic zinc finger, C2H2 0.0051
Further Details:      
 
Domain Number 6 Region: 500-552
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.18e-21
Family Classic zinc finger, C2H2 0.003
Further Details:      
 
Domain Number 7 Region: 224-276
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.07e-17
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 
Domain Number 8 Region: 421-453
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000198
Family Classic zinc finger, C2H2 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000030710   Gene: ENSMODG00000008550   Transcript: ENSMODT00000032280
Sequence length 556
Comment pep:novel chromosome:BROADO5:3:503254359:503265891:1 gene:ENSMODG00000008550 transcript:ENSMODT00000032280 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVRPPLCWARTQSPRLNAPQPPPPPGIKTLPFTKKIEERMTLMLLTAKACQELVTFKDVA
VDFSWEEWEYLAPSQKALYREVMLENYQNLVCLGLEDSKPDVIEQLEQQGAPGMREGAVL
ASTCPDWETRHETKELERQQSYKKHHHQAKTFQRENSKKLKHHKCKKYDQGSTFVSQQKL
EKSSSYNSDFLKCHRINTQEKPHEYNEGRKTYQSSLPTISIGEKLHKCNDCGMSFLNSLQ
LIEHWSIHAGEKPNECNECGKVFRWSSGLTEHQRIHTGEKPYKCNECGKTFSHRSSLTSH
YRIHSGEKTYECNECGKAFYWTSELTKHQRIHTGEKPFECNECGKAFHQSIHLIQHQRTH
TGEKPYKCNECGKAFGRIALLTEHKRIHTGEKPYECSECGMAFRWNSGLTEHQIIHRGEK
PYECTECGKTFSRRSSLTSHHRIHSGKKPYDCNKCGKAFYWLSKLTKHQRTHTGEKPFEC
NECGKTFNRNLHLVQHQGIHTGEKPFECNECGKAFNRSIHFIQHQRIHTGEKPYECNECG
KAFCQSSGLTRHQKIH
Download sequence
Identical sequences F7BM37
ENSMODP00000030710 ENSMODP00000030710

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]