SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000030733 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000030733
Domain Number 1 Region: 11-71
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.96e-25
Family KRAB domain (Kruppel-associated box) 0.001
Further Details:      
 
Domain Number 2 Region: 302-359
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.2e-24
Family Classic zinc finger, C2H2 0.0054
Further Details:      
 
Domain Number 3 Region: 358-415
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.91e-24
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 4 Region: 404-456
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.44e-19
Family Classic zinc finger, C2H2 0.0036
Further Details:      
 
Domain Number 5 Region: 269-316
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000605
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 6 Region: 191-245
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000387
Family Classic zinc finger, C2H2 0.018
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000030733
Domain Number - Region: 238-265
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.082
Family Classic zinc finger, C2H2 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000030733   Gene: ENSMODG00000027655   Transcript: ENSMODT00000032303
Sequence length 476
Comment pep:novel chromosome:BROADO5:3:503206241:503217423:-1 gene:ENSMODG00000027655 transcript:ENSMODT00000032303 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVGPEHLTAWAPQELVSFSDVAVDFSWEEWGHLAPSQKELYQEVMLENYRNLVDLGFAIS
KPDVISKLEQGKAPWMPEEKGLRCGCTTWEMRPKIPKMGISMDLLSLERLSSEGICDSKL
GKSCECTARLKRKQNNEEKHFRVKIIQKNSLNAVKSNNYNKWFGLWPVHSSHQGKQIGKS
LYKYNKDQKSYSLNSDLRRNSDIYLKKILSKHNEYEKSFSHNSTFMEYQRNCTGEKLCEF
DECGKSICLDSSIASYHRIHSEEKQNKSDNCGECFSQSLQLIDHQVTPPGEKAYECNECG
KTFRYSSSLTSHHRIHTGEKPYECNECGKTFRHCSSLTSHHRIHTGEKPYECNECGKTFG
QSIQLLGHRRIHTGEKPYECNYCGKNFRHSSSLISHHRIHTGEKPYECNECGKTFRHCSS
LTFHLKIHTGEKPYECRECGKAFRQRSHLTCHQRLHFGEKLSKYNENQKDFSHTLC
Download sequence
Identical sequences F7AZ45
ENSMODP00000030733 ENSMODP00000030733 XP_007490291.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]