SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000030805 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000030805
Domain Number 1 Region: 39-98
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 3.27e-26
Family KRAB domain (Kruppel-associated box) 0.00093
Further Details:      
 
Domain Number 2 Region: 644-701
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.58e-25
Family Classic zinc finger, C2H2 0.0031
Further Details:      
 
Domain Number 3 Region: 588-645
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.1e-24
Family Classic zinc finger, C2H2 0.0054
Further Details:      
 
Domain Number 4 Region: 420-477
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.27e-24
Family Classic zinc finger, C2H2 0.0051
Further Details:      
 
Domain Number 5 Region: 532-589
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.5e-24
Family Classic zinc finger, C2H2 0.0037
Further Details:      
 
Domain Number 6 Region: 309-365
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.89e-23
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 7 Region: 476-533
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.61e-23
Family Classic zinc finger, C2H2 0.0038
Further Details:      
 
Domain Number 8 Region: 365-421
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.76e-22
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 9 Region: 690-742
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.43e-19
Family Classic zinc finger, C2H2 0.0052
Further Details:      
 
Domain Number 10 Region: 256-309
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000352
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000030805
Domain Number - Region: 198-249
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0109
Family Classic zinc finger, C2H2 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000030805   Gene: ENSMODG00000005370   Transcript: ENSMODT00000032375
Sequence length 747
Comment pep:novel chromosome:BROADO5:4:399439112:399461809:1 gene:ENSMODG00000005370 transcript:ENSMODT00000032375 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEAWVHVLEKRAVPRGQLQRCAEWRRGEKEMPSGFLAAQTKESVTFKDVSVDFTREEWGQ
LDPTQKNLYRDVMLENYRNLVSLGLQVFKPDVITRLERAEAPWTLENKGFRPTCLDWEMK
PETKEIFSKRGMYMNVSLPEKLKSDDPWDYTLGRVWDYDRKFKKQRNSQEKESREVGVIP
KKTASDMRSQEGNLGRNFGQMSLLVAQQDSTTKKHLHQYDTGGNSFKQYSELIKYNRISP
GLKPYKYEYNKASNSNSDLIQYSRISTVERISNFDEFGKAFQQKKHLIQPQINHAGHKVY
KCGECGKFFRQSMHLIQHQRIHTGEKPYHCNECGKSFRQKIHLIRHQTLHSEEKPFKCNH
CGKCFSDSSSLNVHQRIHTAEKPYHCSECGKAFSLSQYLIQHQQIHTTEKRYKCGECGKA
FSLSQYLIRHQKIHTGEKPYECNECGQTFTQQGSLTQHQRSHAGEKPYKCSECGKAFGRS
LYLTRHQRIHTGEKPHICGECGKSFNDTAVLALHQRIHTGEKPCKCNVCGKAFRHTNQVT
QHQRIHTGEKPYKCNECGKAFTHCAGLTHHQRIHTGEKPYKCDECGKAFKQKVYLTQHQR
THTGEKPYKCDECGKTFRQCSALISHKRTHTGEKPYTCRECGKAFSHSCSLTLHQRIHTG
EKPYKCNECGKAFSQNIFLTRHQRTHTGEKPFKCSECGKVFSQSMSLTRHQKTHTGEKPY
KCDECGKGFIQKIQCIQHQKIHTGEKS
Download sequence
Identical sequences F7EWL9
ENSMODP00000030805 ENSMODP00000030805 XP_007492245.1.35504 XP_016277807.1.35504 XP_016277808.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]