SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000030832 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000030832
Domain Number 1 Region: 457-514
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.38e-25
Family Classic zinc finger, C2H2 0.0033
Further Details:      
 
Domain Number 2 Region: 569-626
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.28e-24
Family Classic zinc finger, C2H2 0.004
Further Details:      
 
Domain Number 3 Region: 681-738
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.97e-24
Family Classic zinc finger, C2H2 0.0029
Further Details:      
 
Domain Number 4 Region: 18-78
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 4.58e-24
Family KRAB domain (Kruppel-associated box) 0.0015
Further Details:      
 
Domain Number 5 Region: 513-570
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.14e-24
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 6 Region: 402-458
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.05e-23
Family Classic zinc finger, C2H2 0.004
Further Details:      
 
Domain Number 7 Region: 738-794
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.83e-23
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 8 Region: 346-402
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.29e-22
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 9 Region: 261-318
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.79e-22
Family Classic zinc finger, C2H2 0.0048
Further Details:      
 
Domain Number 10 Region: 625-682
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.94e-21
Family Classic zinc finger, C2H2 0.0067
Further Details:      
 
Domain Number 11 Region: 779-831
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.26e-20
Family Classic zinc finger, C2H2 0.0052
Further Details:      
 
Domain Number 12 Region: 206-262
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000475
Family Classic zinc finger, C2H2 0.0087
Further Details:      
 
Domain Number 13 Region: 308-340
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000178
Family Classic zinc finger, C2H2 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000030832   Gene: ENSMODG00000023638   Transcript: ENSMODT00000032403
Sequence length 841
Comment pep:novel chromosome:BROADO5:4:399499930:399522369:-1 gene:ENSMODG00000023638 transcript:ENSMODT00000032403 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNMEEEEGMASGFLTAKSRKSMSFKDVSVDFTQGEWGQLDPSQRDLYRDVMLENYRNLVS
LELQVIKPEVISRLERGEAPCMLEREGLIGSCPDNDTRFGFTMTDSKDGIIPMEESLQER
FQMNVPLDCKLEQVWEYDALFEKQLSNYERDLRQVTITDNNTSTEVNNQECNKFGRSFGM
MLITNTQENVTSKKSVPKYDTRGNGFKQYSELIRRNRIAFGKKPYKYNECSKAFNYHSDL
IRYHRLPSGKKSYDFDELGQSFPQRRHLIQHARIPSGEKPYKCSECGIAFRQSMHLIQHQ
RIHTGERPYKCSDCGQAFRQKMHLIRHKTLHSGEKPYQCNQCIKCFSDSWSLALHQRIHT
GEKPYNCSECGKAFRQKIHLTRHKTLHIGEKPFKCNQCGKCFSDSSPLLLHQRIHTAEKP
YKCSECGKAFRQSMYLIRHQRTHTGEKPFICGDCGKSFNDSSALTLHQRIHTGEKPYECK
ECGQAFSHSGSLTQHQRIHTGEKPYPCSECGKAFRQYSALAHHERTHTGEKPYICTECGK
AFSHSGTLTQHQRIHTGEKPYECSDCGQAFTYQASLTKHQRSHTGERPYKCSECGKSFNQ
NIYLTQHQRIHTGEKPYKCGDCGKSFSHRGSLTAHQKIHTGEKSCKCPVCGKAFRHMNQV
TQHLRIHTGEKPYTCMECGKSFSHSGSLTTHLRIHTGEKPYKCGECGKAFNQNIYLTQHQ
RIHTGEKPYTCNKCGKNFRQYSALSHHERTHTGEKPYTCMECGKAFSQKGTLTNHQKTHT
GEKPFICGECGKAFNQNIYLTKHQRIHTVEKPFKCNECGKAFKQVSALKHHKRIHNRGKT
L
Download sequence
Identical sequences F7ED84
ENSMODP00000030832 ENSMODP00000030832 XP_007492246.1.35504 XP_007492247.1.35504 XP_007492248.1.35504 XP_007492249.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]