SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000030841 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000030841
Domain Number 1 Region: 499-556
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.8e-27
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 2 Region: 611-668
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.46e-27
Family Classic zinc finger, C2H2 0.0048
Further Details:      
 
Domain Number 3 Region: 555-612
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.25e-26
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 4 Region: 695-752
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.84e-26
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 5 Region: 808-864
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.65e-25
Family Classic zinc finger, C2H2 0.0037
Further Details:      
 
Domain Number 6 Region: 359-416
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.69e-25
Family Classic zinc finger, C2H2 0.0095
Further Details:      
 
Domain Number 7 Region: 751-808
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.9e-23
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 8 Region: 9-69
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 7.85e-22
Family KRAB domain (Kruppel-associated box) 0.001
Further Details:      
 
Domain Number 9 Region: 443-500
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.18e-21
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 10 Region: 849-901
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.85e-20
Family Classic zinc finger, C2H2 0.0044
Further Details:      
 
Domain Number 11 Region: 321-373
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.19e-19
Family Classic zinc finger, C2H2 0.0048
Further Details:      
 
Domain Number 12 Region: 276-332
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.13e-17
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 13 Region: 658-690
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000304
Family Classic zinc finger, C2H2 0.0038
Further Details:      
 
Domain Number 14 Region: 238-289
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000011
Family Classic zinc finger, C2H2 0.0049
Further Details:      
 
Domain Number 15 Region: 406-438
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000227
Family Classic zinc finger, C2H2 0.0083
Further Details:      
 
Domain Number 16 Region: 196-236
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000014
Family Classic zinc finger, C2H2 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000030841   Gene: ENSMODG00000023640   Transcript: ENSMODT00000032412
Sequence length 911
Comment pep:novel chromosome:BROADO5:4:399663716:399700754:-1 gene:ENSMODG00000023640 transcript:ENSMODT00000032412 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALGIQRPPWQDSLTFKDVTVDFTQEEWHLLNHSQKELYKTVMLENSQNLLSLGIPVVRE
DLISHFEEKEALWILDQKGLKNSSLDGETSFEMNETTAKLSNSVDKIHQHRFMSHGSYDF
NMREICDSDIKIGKHQRSHCEADKDGKDFRHYSVLIKNKKMVSGKDYFQYSENRKCFTEK
FGHEKLPEVQISQGNQWGMSRCLNSDIIRHQKSHKGEILYKCNECGMACSQNLKLIDYHE
CNQCRKVFTQNSKHVQHQKIHTGENPHECHQSGKPFQLCSHLAVHQKNHTGEKPHECHKC
GRAFDKHSSLIAHQRVHNIKKPYKCNQCEKAFKHTLSLSLHQRIHTGEKPYECIQCGKAF
TESSSLARHQRIHSGEKPYECSQCRKTFRQNSSLAVHQRIHTEEKPYKCNQCGKAFKENL
KLAVHQRIHTEEKPFECNQCGKTFQCSSSLAIHQKNYTGEKPHECHECDKAFSEHSSLVA
RQRIHTGEKPYKCNQCGKAFTQKSSLAVHQRIHTEEKPYECNQCGKAFTQKSSLAVHQRI
HTGEKPYKCNQCGKAFKQNSKLVLHQRIHTGEKPYECNQCGKAFTQNSHLSKHQRIHTGE
KPYECNQCGKAFTGKSSLAVHQRIHTGEKPYECNQCGKAFTEKSSLAVHQRIHTGEKPYK
CNQCGKAFKRNSELVLHQRIHTGEKPYECNQCGKAFKENSSLAVHQRIHTGEKPYKCNQC
GKAFKENSSLAVHQRIHTGEKPYKCNQCGKAFPYRALLAYHLKIHTGEKPYECNQCEKTF
MKKSNLAIHQRIHTGEKLYECNECGKNFINKSSLAVHQRIHTGEKPYKCKQCGKDFTQNA
NLLKHQRIHTGEKPYECHQCGKAFTDNSKLACHQRIHTGEKPYECHQCGKAFTQNSHLSK
HQRIHSSMGEA
Download sequence
Identical sequences F7ECR7
ENSMODP00000030841 XP_007492255.1.35504 XP_007492257.1.35504 XP_007492258.1.35504 XP_016277813.1.35504 XP_016277815.1.35504 ENSMODP00000030841

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]