SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000030853 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000030853
Domain Number 1 Region: 683-740
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.01e-24
Family Classic zinc finger, C2H2 0.0071
Further Details:      
 
Domain Number 2 Region: 515-572
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.02e-24
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 3 Region: 404-460
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.45e-24
Family Classic zinc finger, C2H2 0.0071
Further Details:      
 
Domain Number 4 Region: 627-684
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.35e-24
Family Classic zinc finger, C2H2 0.0051
Further Details:      
 
Domain Number 5 Region: 179-236
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.24e-24
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 6 Region: 459-516
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.58e-23
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 7 Region: 572-628
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.77e-23
Family Classic zinc finger, C2H2 0.0049
Further Details:      
 
Domain Number 8 Region: 347-404
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.82e-23
Family Classic zinc finger, C2H2 0.0051
Further Details:      
 
Domain Number 9 Region: 9-71
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 2.35e-22
Family KRAB domain (Kruppel-associated box) 0.0014
Further Details:      
 
Domain Number 10 Region: 291-348
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.71e-22
Family Classic zinc finger, C2H2 0.0087
Further Details:      
 
Domain Number 11 Region: 725-777
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.78e-20
Family Classic zinc finger, C2H2 0.0045
Further Details:      
 
Domain Number 12 Region: 235-292
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.47e-19
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 13 Region: 141-193
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.4e-18
Family Classic zinc finger, C2H2 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000030853   Gene: ENSMODG00000023642   Transcript: ENSMODT00000032424
Sequence length 784
Comment pep:novel chromosome:BROADO5:4:399925468:399936097:-1 gene:ENSMODG00000023642 transcript:ENSMODT00000032424 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASVLLAAPAQKSLTFKDVAVDFTKEEWRQLNPSQRDMYRDVMLENYKNLVFLVGLLGSQ
PDVISQLEKGEVPWMPEGEISRNPSLDSIIQNTRHKATESVPKSAVSLGESSKELLKKDR
SCIAILGDDWECDVRKLTGKKTCECSECGKAFSTRSSLKGHLRLHTGERPFVCSECGKAF
IQRAKLNVHKRIHTGEKPFECQECGKAFRYSISLTEHKRIHTGEKPFECKECGKVFRQSS
ALRRHLVLLAGEGPPKCNLCGKAFIESGKLTAHKRIHTGEKPFHCKECGKTFSYISSLRD
HCRFHTGENRHECNECGKSFSRSTSLKGHQKIHTGEKPYVCNECGKAFIEKVRLTEHKRI
HTGEKPFECNECGKAFSHSSSLRYHRRLHTGEKRYKCNECGKCFSASSTLRKHQRTHTGE
KPFACTECGKAFIERGRLTEHMRIHTGEKPFECNECGKAFSYTTSLTEHQRIHTGEKPFE
CSECGKAFSQSSTLRTHQLTHTGEKSFECNECKKAFSSRSSLKLHWRIHTGEKKFECSEC
GKSFIRSSSLMKHQRIHTGEKPFACSECGKAFIERGRLNEHMRIHTGEKPFECHECGKAF
SYIASLTEHKRIHTGEKPLECNVCGKAFRHRIGLTAHKRIHTEEKPFECKECGKAFSNSS
NLMMHWRLHTGEKPFKCNECGKAFSNSSNLRTHQRLHTGEKPFDCNQCGKAFREKRQLTL
HKRIHTGEKPYECNECGKAFSYPTSLTEHKRIHTGEKPLECNECGKTFSHSSSFRNHKKC
HTKE
Download sequence
Identical sequences F7DUY2
ENSMODP00000030853 ENSMODP00000030853

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]