SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000030861 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000030861
Domain Number 1 Region: 818-875
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.15e-26
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 2 Region: 594-651
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.05e-25
Family Classic zinc finger, C2H2 0.0031
Further Details:      
 
Domain Number 3 Region: 650-707
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.66e-25
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 4 Region: 986-1043
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.97e-25
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 5 Region: 930-987
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.57e-25
Family Classic zinc finger, C2H2 0.0035
Further Details:      
 
Domain Number 6 Region: 309-365
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.36e-25
Family Classic zinc finger, C2H2 0.0045
Further Details:      
 
Domain Number 7 Region: 448-505
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.42e-25
Family Classic zinc finger, C2H2 0.0075
Further Details:      
 
Domain Number 8 Region: 1154-1211
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.03e-24
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 9 Region: 1042-1099
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.32e-24
Family Classic zinc finger, C2H2 0.0037
Further Details:      
 
Domain Number 10 Region: 364-421
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.35e-24
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 11 Region: 706-763
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.72e-24
Family Classic zinc finger, C2H2 0.0056
Further Details:      
 
Domain Number 12 Region: 762-819
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6e-24
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 13 Region: 874-931
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.44e-23
Family Classic zinc finger, C2H2 0.0045
Further Details:      
 
Domain Number 14 Region: 1098-1155
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.48e-23
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 15 Region: 252-309
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.49e-22
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 16 Region: 100-160
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 3.01e-21
Family KRAB domain (Kruppel-associated box) 0.0012
Further Details:      
 
Domain Number 17 Region: 533-595
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.09e-20
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 
Domain Number 18 Region: 1196-1248
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000726
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 
Domain Number 19 Region: 199-252
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000148
Family Classic zinc finger, C2H2 0.02
Further Details:      
 
Domain Number 20 Region: 411-443
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000559
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number 21 Region: 495-527
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000929
Family Classic zinc finger, C2H2 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000030861   Gene: ENSMODG00000023643   Transcript: ENSMODT00000032432
Sequence length 1253
Comment pep:novel chromosome:BROADO5:3:502305507:502561971:1 gene:ENSMODG00000023643 transcript:ENSMODT00000032432 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPRAVPSRPPPASHKAGMLRPRGKRSAPSCVRREKSWEVGTPEAPAAFSVFPKARRPERP
KRQDQEKMEEFHQMDSLGLLCCLYREPGVSGMALERDRLPAQEAVTFKEVAVDFTQEEWR
LLSPPQKELYKEVMLENARNLLSVGLPGTPEDMISSLEQREAPWILEQEGLRNCCPGLQK
FMSDGSNKFAFREFCVVPQNSSHIEHQRMHTEEKSSEINECQKTFMNRTSLARHQRIHTT
GRPFECKSGRKTYRVSSSLAVHQRIPTGEKPYECKHCGKTFSHSLSLVEHQRTHTGEKPY
ECKHCRKPFTNSSNLAVHQRIHTGEKPYKCKQCGKTFIQRSHFAAHQRIHTGEKPYDCKQ
CGKTFSQSYSLVVHQRIHTGEKPYECKQCGKTFTNNSNLAVHQRIHTGEKPYECKLCEMT
FSESSSLSVHQRIHTGEKPYECKRCEKTFNRISSLVQHQRTHTGEKPYECKQCEKTFNSN
SSLAAHQRIHTGEKPYDCKQCGKTFSRRDQLAVHQRTHTGEKPCECKQCGKTFNSNSSLA
HHERIHTGEKPFECKHPYDCKQCGKAFSCSSTLAVHQRIHTGEKPYECKQCGKTFRLSST
LATHERIHTGEKPYECQQCGKTFSRSSSLAEHQRIHTGEKPYECQQCGKAFTCSSALTVH
QRIHTGEKPYECKQCGKTFSCNSALAVHLRIHTGEKPYECQQCGKAFICSSALAVHRRIH
TGENPYECQQCGKAFICSSTLAVHQRVHTGEKPYECQQCGKAFTCSSSLAVHQRIHTGEK
PYECKHCEKTFRFSSTLAVHKRIHTGEKPYECQQCGKAFSRSSHLALHQRIHTGEKPYEC
KQCGKAFSCSSALAAHQRIHTGEKPYECQQCGKAFSCNSALAVHRRIHTGEKPYECKQCG
KGFICSSALAVHRRIHTGENPYECKQCGKAFICSSTLAVHQRVHTGEKPYECQQCGKAFS
RSSHLAVHQRIHTGEKPYECPQCRKAFICSSALAEHQRTHTGEKPYECKQCGKAFNYSSH
LAVHQRIHTGEKPYECKWCGKTFRLSSQLAVHERIHTGEKPYKCKQCGKTFSRSSSLAEH
QRIHTGVKPYECKHCGKTFNWSSHLAVHERIHTGEKPYECEQCRKTFRLSSHLAVHERIH
TGEKPYECKQCKKTFSRSSHLAVHQRTHTGEKPYECQQCRKTFSRSSSLAEHKRIHTGEK
PYECQQCGKTFRLSSQLAVHQRIHVGEKHYEYKQCRKALTKNYCFAVHQEIHT
Download sequence
Identical sequences F7DUH7
ENSMODP00000030861 ENSMODP00000030861

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]