SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000030871 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000030871
Domain Number 1 Region: 599-656
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.28e-25
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 2 Region: 487-544
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.42e-25
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 3 Region: 375-432
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.95e-25
Family Classic zinc finger, C2H2 0.0049
Further Details:      
 
Domain Number 4 Region: 543-600
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.54e-25
Family Classic zinc finger, C2H2 0.0053
Further Details:      
 
Domain Number 5 Region: 263-320
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.42e-24
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 6 Region: 431-488
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.13e-24
Family Classic zinc finger, C2H2 0.0054
Further Details:      
 
Domain Number 7 Region: 319-376
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.36e-24
Family Classic zinc finger, C2H2 0.0052
Further Details:      
 
Domain Number 8 Region: 207-264
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.74e-22
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 9 Region: 33-93
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 2.22e-21
Family KRAB domain (Kruppel-associated box) 0.0012
Further Details:      
 
Domain Number 10 Region: 645-697
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.69e-20
Family Classic zinc finger, C2H2 0.0057
Further Details:      
 
Domain Number 11 Region: 154-206
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000146
Family Classic zinc finger, C2H2 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000030871   Gene: ENSMODG00000023645   Transcript: ENSMODT00000032442
Sequence length 702
Comment pep:novel chromosome:BROADO5:3:502311655:502323901:1 gene:ENSMODG00000023645 transcript:ENSMODT00000032442 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEEFHQMDSLGVLECLNRDPGVPGIALETDRLPAQEAVTFKEVAVDFTWEEWRLLSPPQK
ELYKEVMLENAQNLLSVGLPGPPEDVISSLEQREAPWILEQESLRSCCPEGEIRPEMKEN
PTEMNSSMEEIDLQRFMSDGSNEFAFREFCVIPQNSSHIEHQRMHTEEKSSEINECPKTF
IHRTRLARRQRLHTKDRLYECKPGRKTYRESSSLAVNQRVHSSEKPYKCKQCGKTFSQQS
SVAVHQRIHTGERPYECKQCGKTFSHSSSHVEHQRIHTGEKPYECKACGKVFSHSSSLAA
HQRIHTGQKPYKCNQCGKTFRYRNHFATHQRIHTGEKPYECKQCKKTFSFRSNLAEHQRI
HTGEKPYECKECGKAFSHSSSLSVHQRIHTGEKPYECRQCGKTFTSNSQLAVHHRTHTGE
KPYECKQCGKTFSRRDQLAVHQRTHTGEKPHECKQCEKTFNRKSSLAEHQKIHTGEKPYE
CKQCGKTFSHSSSLAAHQRIHTGEKPYDCKQCGKTFSQRSHFAAHQRIHTGEKPYDCKQC
GKTFSQSSTLSVHQRIHTGEKPYKCKQCGKTFTNNSNLAVHQRTHTGEKPYECKHCEMTF
SESSSLAVHQRIHTGEKPYDCKQCGKTFSQSSSLAAHQRIHTGEKPYECKQCGNAFSQSS
SLAVHQRIHTGEKPYECKQCGKTFGHSSTLSVHQRRHTAEKP
Download sequence
Identical sequences F7D9X0
ENSMODP00000030871 ENSMODP00000030871 XP_016288299.1.35504 XP_016288300.1.35504 XP_016288301.1.35504 XP_016288302.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]