SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000030885 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000030885
Domain Number 1 Region: 303-360
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.96e-26
Family Classic zinc finger, C2H2 0.0052
Further Details:      
 
Domain Number 2 Region: 219-276
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.57e-25
Family Classic zinc finger, C2H2 0.0079
Further Details:      
 
Domain Number 3 Region: 359-416
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.47e-25
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 4 Region: 611-668
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.06e-24
Family Classic zinc finger, C2H2 0.0056
Further Details:      
 
Domain Number 5 Region: 415-472
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.16e-24
Family Classic zinc finger, C2H2 0.0054
Further Details:      
 
Domain Number 6 Region: 555-612
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.25e-24
Family Classic zinc finger, C2H2 0.0049
Further Details:      
 
Domain Number 7 Region: 163-220
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.58e-24
Family Classic zinc finger, C2H2 0.0051
Further Details:      
 
Domain Number 8 Region: 499-556
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1e-22
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 9 Region: 653-705
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.32e-22
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 10 Region: 33-79
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.83e-19
Family KRAB domain (Kruppel-associated box) 0.0015
Further Details:      
 
Domain Number 11 Region: 266-298
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000133
Family Classic zinc finger, C2H2 0.015
Further Details:      
 
Domain Number 12 Region: 462-494
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000758
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000030885
Domain Number - Region: 124-164
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000595
Family Classic zinc finger, C2H2 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000030885   Gene: ENSMODG00000023647   Transcript: ENSMODT00000032456
Sequence length 715
Comment pep:novel chromosome:BROADO5:3:502010509:502025554:-1 gene:ENSMODG00000023647 transcript:ENSMODT00000032456 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEKLHQMDSLGLFCCLYREPVVPGMALERDRLPTQEMVTFQDVAVEFTWEEWHLLSPPQK
ELYKDVMLENARNLLSVEGEFRPEMKENPTEMSLSVEEMELQRFMSDSPSKFPFREFCVA
PQNLSHIEHQIMHIEEKSSEINEFGKSNHTEERPKECKECEKAFSQSSSLVAHQRMYTGE
KPYECKQCGKTFSQSSRLAVHWRVHTGEKPYECKHCGQTFRQRSNLVAHQRIHTDEKLYE
CNQCGKTFSQRSSLGLHQRIHTGEKPYKCNQCEKTFKCKSSLYAHQRIHTGEKSYECNQC
GKTFSQRSSLGLHQRIHTGEKPYECKQCGKTFRQSSGLAAHQRIHTGEKPYECNQCGKTF
SQRSSLGLHQRFHTGEKPYECKQCGKSFIQSSSLAEHQRIHTGEKPYECKHCGKTFRTSF
RLAVHKRIHTGEKPYECKQCGKTFRQSSSLAAHRRIHTGEKPYECKQCGKTFRQGFHLAV
HQRIHTGQKYYECKQCGKTFSCHSNFAVHQRIHTGEKPYECKHCGKTFSHSSSVAAHQRV
HTGEKPYECKHCGQTFRQKSNLAAHQRIHTGEKPYECKQCGKTFCMSSRLAVHQRIHTGE
KSFECKQCGKTFLHSSSLAEHQRIHTGEKPYECKQCGKAFSCHSNFAVHQRTHTGEKPYE
CKQCGKTFSQSSSLAAHQRIHTGEKPYECKQCGKTFRQSSGLAAHQRIYTGEKLL
Download sequence
Identical sequences F7D9C6
XP_016288353.1.35504 ENSMODP00000030885 ENSMODP00000030885

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]