SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000030896 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000030896
Domain Number 1 Region: 227-284
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.89e-27
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 2 Region: 339-396
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.67e-26
Family Classic zinc finger, C2H2 0.0038
Further Details:      
 
Domain Number 3 Region: 395-452
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.26e-26
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 4 Region: 451-508
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.71e-26
Family Classic zinc finger, C2H2 0.0044
Further Details:      
 
Domain Number 5 Region: 283-340
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.46e-25
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 6 Region: 171-228
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.81e-25
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 7 Region: 2-58
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.03e-19
Family KRAB domain (Kruppel-associated box) 0.0013
Further Details:      
 
Domain Number 8 Region: 119-172
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.56e-16
Family Classic zinc finger, C2H2 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000030896   Gene: ENSMODG00000023648   Transcript: ENSMODT00000032467
Sequence length 525
Comment pep:novel chromosome:BROADO5:3:501986992:501994568:-1 gene:ENSMODG00000023648 transcript:ENSMODT00000032467 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EVVMFKDVDVDFTREEWRLLSPPQKELYKEVMLENARNLLSVGLPAPPEDMISSLEQREA
LWMLELEDLRSCCPGEIRPEMKKNPVDMSASVLEMDLQRFMSNGPDNFAFRVFCVAPQNS
SDIEHQRMHTEEKSSESNEYGRTFLNGDSLAEHQRMHTGEKPYECKECGKTFLKSSQLGV
HQRIHTGEKPYECKQCGKKFTDKSTLSKHQRIHTGEKPYECKQCGKTFSRSSHLAVHQRI
HTGEKPYECKQCGKSFSQSSSLFVHQRIHTGEKPYVCKQCGKSFSRSSSLFLHQRIHTGE
KYYECKQCGKSFSCSSNLAVHQRIHTGEKPYECKECGKTFRLSSHLAVHQRIHTGEKPYV
CKQCGKSFSRSSNLFLHQRIHTGEKPYECKQCGKTFSMSSHLAVHQRIHTGERPYKCKQC
GKTFTNNSHLAVHQRIHTGEKPYECKQCGKTFRRGFHLAVHQRIHTGEKPYECKQCGKAF
TNNSHLAVHQRIHTGEKPYECKQCGKAFKERSKLTVHHRIHTGEK
Download sequence
Identical sequences F7D907
ENSMODP00000030896 ENSMODP00000030896 13616.ENSMODP00000030896

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]