SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000030900 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000030900
Domain Number 1 Region: 367-424
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.31e-26
Family Classic zinc finger, C2H2 0.0044
Further Details:      
 
Domain Number 2 Region: 8-70
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.22e-25
Family KRAB domain (Kruppel-associated box) 0.001
Further Details:      
 
Domain Number 3 Region: 591-648
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.75e-25
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 4 Region: 423-480
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.7e-24
Family Classic zinc finger, C2H2 0.0054
Further Details:      
 
Domain Number 5 Region: 311-368
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.54e-24
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 6 Region: 647-704
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.56e-24
Family Classic zinc finger, C2H2 0.0051
Further Details:      
 
Domain Number 7 Region: 759-816
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.11e-24
Family Classic zinc finger, C2H2 0.0044
Further Details:      
 
Domain Number 8 Region: 479-536
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.49e-24
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 9 Region: 535-592
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.55e-23
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 
Domain Number 10 Region: 804-863
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.14e-21
Family Classic zinc finger, C2H2 0.0045
Further Details:      
 
Domain Number 11 Region: 703-760
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.23e-21
Family Classic zinc finger, C2H2 0.0054
Further Details:      
 
Domain Number 12 Region: 255-312
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.15e-19
Family Classic zinc finger, C2H2 0.0071
Further Details:      
 
Domain Number 13 Region: 200-256
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000467
Family Classic zinc finger, C2H2 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000030900   Gene: ENSMODG00000014356   Transcript: ENSMODT00000032471
Sequence length 864
Comment pep:novel chromosome:BROADO5:4:400054449:400075310:-1 gene:ENSMODG00000014356 transcript:ENSMODT00000032471 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTSGFLIATSQESVTFKDVSVDFTQGEWGQLDLSQKNLYRDVMLENYRNLVSLGLQVFKP
EVICRLERGEAPWVLEREISRGPRIDLFPFPVNWPETRETVSMESFYMAELSQERLIRDD
SWDFKLEEAPKCISKFKREQVNQGRELKQIITHKSNSNKMKSHEHDKFRRSSSHRSVSVI
QWSSPTEKIIHKYDTYVNNFKQYSDLVKHNRISSGRKLWKSNDYNKTFCYHSDLIRYHRL
PTGEKSYTYPEFGKTFHQKRHLTQYKRIPAVEKPYKCTDCEKSFSNSTSLILHQRIHTGE
KPYECLECGKTFSRSMYLTRHQRIHTRERPYKCSECGKAFSQIMYLARHQKIHTGDRPYQ
CNECGKAFSQILYLTRHQRTHTGERPYQCNECGKAFSQIMYLTRHQRIHTGERPYKCSEC
GKAFSNSSSLIVHQRIHTGERPYKCDICEKAFSQRGHLTEHQKIHNREKPYKCTECGKAF
SQIMYFNQHQRIHTGEKPYKCNECGKAFSNSSTFIVHHRIHTGEKPYECLECGKAFSKCT
GLVLHKRIHTGEKPYKCNVCEKTFSRRGHLTEHQKIHNGEKPYKCDECGKSFRQRGHLTE
HQRTHTGEKLYKCNECGKAFSNSSQLTLHHRIHTGEKPYKCSECGKAFINSSFLTLHQRI
HTGEKPYKCNECGQAFRHPGNLTEHRKIHTGEKPYTCSECGKSFSRSMYLTRHQRVHTGE
KCYKCNMCNRAFQNSSSLTLHERIHSGDKPYKCFECGKAFSQGLYLTRHQRIHTGEKPYK
CNECGKAFNQSAGLIQHQIVHTVDKPYKCDECGKTFSRQGSVIQHQRIHTGEKPYVCSDC
GRAFTHSSSLAVHQRIHTGEKSYE
Download sequence
Identical sequences F6ZKL6
ENSMODP00000030900 ENSMODP00000030900

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]