SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000030918 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000030918
Domain Number 1 Region: 15-132
Classification Level Classification E-value
Superfamily POZ domain 2.47e-28
Family BTB/POZ domain 0.0000805
Further Details:      
 
Domain Number 2 Region: 359-415
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.06e-21
Family Classic zinc finger, C2H2 0.0075
Further Details:      
 
Domain Number 3 Region: 400-452
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.02e-16
Family Classic zinc finger, C2H2 0.015
Further Details:      
 
Domain Number 4 Region: 320-372
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000207
Family Classic zinc finger, C2H2 0.0085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000030918   Gene: ENSMODG00000006161   Transcript: ENSMODT00000032489
Sequence length 474
Comment pep:known_by_projection chromosome:BROADO5:2:255693801:255703123:-1 gene:ENSMODG00000006161 transcript:ENSMODT00000032489 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSVATAVGSLGYVREFTRHASDVLWNLNELRLRGILTDVTLLVGGRALRAHKAVLIACS
GFFYSIFRGRAGLGVDLLSLPGGPEAGGFAPLLDFMYTSRLLLSPATAPAVLAAATYLQM
DHVVEACHRFIQASYEPISISLQPLDAESQAPPMPAAPPEGSPHRFEGHPDPPTESRSCF
HGPPSPASPPSLDPAACNWKKYKFIILNSRTAQAGTPAGKADAAAESPASAKPASGEEAS
SSSGEEGSCSGTGRRLSPALDPALLLPHPSQRNLGSPSEASGPRPGNSFFSCQDCEAGTG
YPEEVRARALTPHSPGNEDKPYKCRLCRCAFRYKGNLASHRTVHTGEKPYHCAICGARFN
RPANLKTHSRIHSGEKPYKCETCGSRFVQVAHLRAHVLIHTGEKPYPCSTCGTRFRHLQT
LKSHVRIHTGEKPYHCEPCNLHFRHKSQLRLHLRQKHGAATNTKVHYHVLRAPC
Download sequence
Identical sequences F6ZJP8
ENSMODP00000030918 ENSMODP00000030918 XP_007483282.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]