SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000031445 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000031445
Domain Number 1 Region: 1653-1794
Classification Level Classification E-value
Superfamily SET domain 7.85e-47
Family Histone lysine methyltransferases 0.0031
Further Details:      
 
Domain Number 2 Region: 6-86
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.00000000000000107
Family Splicing factor U2AF subunits 0.072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000031445   Gene: ENSMODG00000023734   Transcript: ENSMODT00000033018
Sequence length 1797
Comment pep:known_by_projection chromosome:BROADO5:3:485236472:485276145:1 gene:ENSMODG00000023734 transcript:ENSMODT00000033018 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XTFAKLNDNIRENFLTDMCKKYGEVEEVEILYNPKNKKHLGIAKVVFATVKGAREAVQHL
HNTSVMGNIIHVELDTKGETRMRFYELLVNGLYTPQTLPVGIELETSPTVNKTLQLTDAL
KRLKDGSVASASSSASVTPNSSTPFSHDTAYSSSRLDTPNSYGQCTPLTPRLGTPFSQDS
SYSSRQPTPSYHFSQDSGYKARRHETKFTDAYNRRHEHHYVHNSLGAFRSSEHTFGTTAT
SSSGGGGGGGGSSSYKPHVQPEAPQYSHTPPSAPLGHTSSNYKSAFSPYQAPALFAPHPE
EPATMPAFAQGGRDSGEYRRAQPPVEPPAVVAPPAKERPETPPVPPPPPPPELNSSLEPS
GGPNFGWSPERCNSPRTPTLESSPSSSEKPHDSLDSRIEMLLKEQRTKLPFLREHDSDTE
LRMEGSPISSSSSQLSPLPTFGPNSQPSFRGQTPSSRPSSTGLEDISPTPLPDSDDEDLG
LGLGPRPPPEPGPPDPAGLLGHGAETTKEMAGERTPTSEKMDEGQQSSGEDMEISDDELP
SAPITSADCPKPIVVNSSVTTPAVLATSIPLPPPGFPPPLPPPPPPPPQPGFPMPPPLPP
PPPPPPATHPKRMCWWQWAGMHMSFQMQTQMLSRMMQGQGVCQYPRFMGSGMQFVKLCPP
YRPFSMGGAVGRGQQWPPLPKFDPSVPPPGYMPKKEDPHKATVDGVLLVIVKELKAIMKR
DLNRKMVEVVAFRAFDEWWDKKERMAKASLTPVKSGEHKDEERPKPKDRLTSCLLENWSK
GEGLGYEGMALSIGLRGAIRLPSFKVKRKEPPDPASTGDQKRLRPSTSVDEEDEESERDR
DMSDIPSDLSKKDPDGVSIRRRPARPLELDSEGEEEDDKEESSSSSSSSSSSSSSSSSSL
SSSSSSSSEKEEDEEDRLAKTSSDKEEEEEDVDEEEEEDEEDDEEDEEETAEVEMSEKEG
LNSDEEDVRSMASSKVEPASSEESEDSSDYESTSESEEEEEEEEEEEEEEEEEATAAAEA
ESGSLAGEGQDLPGAEIAMEAGTIVKEEEEEMITILELTPVMDEPGSTGLRAEETVGSGD
APEQPGLKQVDMMLEELPTPGPPEPQRHLTPSPVDASGEETELESSEVLKEMSFLSRPPS
PPGLPPEATPQQPLFPARPSQPLPLLEEPLPEELPPRTPGRDPLAKSQSTETVPATPGSE
TPLTASSLALSSPQVPSSPFSYPSQSPGLSGGGIPRTPGRDFSFTPTFPEPMGPLPLSVC
SLPPGKKLPGDDRPGPGAPTSSSPLESGFPLPVSLPVPLSVPVPLPVPLTLPPGPLLPRS
PTLLPLPLTLPLALPLAPSLPTPCPSPIKRKPGRPKRSPPAVLTLDVPPGRLATLPPEAA
GHKLLLLAGQPPATAAFHGAPDPRVVTLDFRNDGGLPPPPPPPPPPPPPPDEATKLPFKE
LENQWLEEPPPPSLGLEEEVDSGNGGGFSKPKLPWRRPPKKRHEDMVVPPLPPPSPDFSS
FEPRTSSLEAWCSYLWSHLAALHFIAFINVKYRVVVEPGTGVCGILVSGLDLSPPTSFST
PKKKKREDGIREHVTGCARSEGYYKIDKKDKLKYLNNSRAFAEEPPADTQGMSIPAQPHA
STRAGSERRSEQRRLLSSFTGSCDSDLLKFNQLKFRKKKLKFCKSHIHDWGLFAMEPIAA
DEMVIEYVGQNIRQVIADMREKRYEDEGIGSSYMFRVDHDTIIDATKCGNFARFINHSCN
PNCYAKVITVESQKKIVIYSKQHISVNEEITYDYKFPIEDVKIPCLCGSENCRGTLN
Download sequence
Identical sequences F6XR34
13616.ENSMODP00000031445 ENSMODP00000031445 ENSMODP00000031445

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]