SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000031661 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000031661
Domain Number 1 Region: 29-144
Classification Level Classification E-value
Superfamily POZ domain 3.06e-24
Family BTB/POZ domain 0.0013
Further Details:      
 
Domain Number 2 Region: 419-471
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000553
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 3 Region: 369-425
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000193
Family Classic zinc finger, C2H2 0.03
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000031661
Domain Number - Region: 184-194
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.00128
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000031661   Gene: ENSMODG00000015096   Transcript: ENSMODT00000019212
Sequence length 497
Comment pep:novel chromosome:BROADO5:2:268107289:268111403:-1 gene:ENSMODG00000015096 transcript:ENSMODT00000019212 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKQKLGGKGVWETLSITPSTMASGVEVLRFQLPGHEAATLRNMNQLRAEERFCDVTIVAD
SLKFRGHKVILAACSPFLRDQFLLNPSSELQVSLMHSARIVADLLLSCYTGALEFAVRDI
VNYLTAASYLQMEHVVEKCRNALSQFIEPKIGLKEDGIGGGIGLTGLTSTKSLLPPARTP
KPAPKPPPPPPPPPLLRPVKLEFPLDEDLELKAEEEEEDEEEDVSDICIVKVESALEVAQ
RLKPPGGIGGSLGLGGSLGLGGNLNLGGGLGLGGSSGLLINEVGETIDAPDDSTAPQGVV
KACYSLTEDTEGEGLLLFPGGRVGEGITLGLGDEALAAATMSRSSGVSGSYGGIRSPIPG
GSPVGNPLKNIKCTKCPEVFQGVEKLVFHMRAQHFIFMCPRCGKQFNHSSNLNRHMNVHR
GVKSHSCGICGKCFTQKSTLHDHLNLHSGARPYRCSYCDVRFAHKPAIRRHLKEQHGKTT
AENVLDASVSELNALLH
Download sequence
Identical sequences F6VSV2
XP_001376349.2.35504 ENSMODP00000031661 ENSMODP00000031661

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]