SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000032324 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000032324
Domain Number 1 Region: 230-335
Classification Level Classification E-value
Superfamily Cystine-knot cytokines 1.25e-28
Family Transforming growth factor (TGF)-beta 0.00064
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000032324
Domain Number - Region: 146-201
Classification Level Classification E-value
Superfamily dUTPase-like 0.0239
Family dUTPase-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000032324   Gene: ENSMODG00000023947   Transcript: ENSMODT00000033903
Sequence length 336
Comment pep:novel chromosome:BROADO5:3:451350235:451351995:1 gene:ENSMODG00000023947 transcript:ENSMODT00000033903 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVSFSMCPIQLRLLPPMLLLLLLPPPPTSGAEPQLMHQERSAELEAIRSAILGRLGLSKP
PDVRPPLLSATEVRRLRRRYEEALAQLRTNRSMEETDLHSSSGPSITKVRILAPKVELSR
DASNLRFHLLLDREALPPPSPPPRTEGATFPLEAEAKSLRFDLTRPLRRWLRPGRTAAPQ
LRMPLALPPSMAPELLRRPPVPRASLRVKFQTPAGRKSRRVRALQPDKDCEEGSGSRCCA
RSQRVSFQELGWADWVLAPREYEMRFCEGSCPHNYRPASLHAQLKARLHSVSPAAVGPPC
CAPSAYEPIVLMHYGSDGQVTLTPFEDLVPTTCHCA
Download sequence
Identical sequences F7BG91
ENSMODP00000032324 ENSMODP00000032324

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]