SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000032390 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000032390
Domain Number 1 Region: 599-863
Classification Level Classification E-value
Superfamily NHL repeat 2.25e-50
Family NHL repeat 0.0000512
Further Details:      
 
Domain Number 2 Region: 481-575
Classification Level Classification E-value
Superfamily E set domains 2.14e-24
Family Filamin repeat (rod domain) 0.0013
Further Details:      
 
Domain Number 3 Region: 264-326
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000000000000305
Family B-box zinc-binding domain 0.002
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000032390
Domain Number - Region: 169-203
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00978
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.02
Further Details:      
 
Domain Number - Region: 25-32,365-466
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0136
Family Formin homology 2 domain (FH2 domain) 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000032390   Gene: ENSMODG00000023957   Transcript: ENSMODT00000033972
Sequence length 863
Comment pep:known_by_projection chromosome:BROADO5:8:292649316:292703202:-1 gene:ENSMODG00000023957 transcript:ENSMODT00000033972 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDALPSSNFLLSNLLDVVVAAEDSPPPPPPPPKNNGRGVVGGGGGGGGSGSNNRHHHHHH
HHHHHPRAPPPQPQPPPTAGSPLQPPQPPPSSSSTSSSSSSQQQQQQPQAQPSSSSSQQQ
QQQQQQQQQPPPPAQHPHREHPHAPRAPSAQSSSSSSSSSSSLMLRRPHSQGEARCSSCD
EGNTASSRCLDCQEHLCDNCVRAHQRVRLTKDHYIERFGSPAAAAAAAAAAAAVAAAAAN
NTAAAAAQLALSQSFPGSPFSILSVFPERVSYCQQHDDEVLHFYCDTCSVPICRECTMGR
HVGHSFIYLQDALQDSRTLTIQLLADAQQGRQAIQLSIEQAQAVAEQVEMKAKVVQSEVK
AVTSRHKKALEERECELLWKVEKIRQVKAKSLYLQVEKLRQNLNKLDSTISAVQQVLEEG
RAMDILLARDRMLAQVQELKTVRSLLKPQEDDRVMFTPPDQALYLAIKSLGFVSSGAFAP
LTKATGEGLKRALQGKVASFTVIGYDHDGEPRLSGGDLMSAVVMGPDGNLFGADVSDQQN
GTYLVSYRPQLEGEHLVSVMMCNQHIENSPFKVLVKSGRSYVGIGLPGLAFGSEGDNDGK
LCRPWGVSVDKEGYIIVADRSNNRIQVFKPCGTFYHKFGTLGSRPGQFDRPAGVACDSSR
RIVVADKDNHRIQIFTFDGQFLLKFGEKGTKNGQFNYPWDVAVNSEGKILVSDTRNHRVQ
LFGPDGAFLNKYGFEGALWKHFDSPRGVTFNHEGHLVVTDFNNHRLLVIHPDCQSARFLG
SEGTSNGQFLRPQGVAVDQEGRIIVADSRNHRVQIFESNGSFICKFGAQGSGFGQMDRPS
GIAVTPDGMIVVVDFGNNRILIF
Download sequence
Identical sequences F6ZFU3
ENSMODP00000032390 ENSMODP00000032390

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]