SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000032522 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000032522
Domain Number 1 Region: 742-856
Classification Level Classification E-value
Superfamily Bromodomain 1.22e-38
Family Bromodomain 0.000000748
Further Details:      
 
Domain Number 2 Region: 539-683
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 1.5e-19
Family N-acetyl transferase, NAT 0.0000000764
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000032522
Domain Number - Region: 29-44
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.00915
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 
Domain Number - Region: 24-91
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.0497
Family beta-sandwich domain of Sec23/24 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000032522   Gene: ENSMODG00000014806   Transcript: ENSMODT00000034106
Sequence length 862
Comment pep:known_by_projection chromosome:BROADO5:8:280245203:280365395:1 gene:ENSMODG00000014806 transcript:ENSMODT00000034106 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSETGGAGPAGGGGGGGSGGAGGQPQQQPPPPPPQPPPVPLPPPLPLPPQGSPAAGGGPA
RAAASAAAASSPAPVPAGAGPGASSGPAAAAAESPGVGSGASTARIAVKKAQLRSAPRAK
KLEKLGVYSSCKAEESCKCNGWKNPNPPPTPPRADLQQIIVNLTESCRSCSHALAAHVSH
LENVAEEEMNRLLGIVLDVEYLFTCVHKEEDADTKQVYFYLFKLLRKCILQMGKPVVEGS
LESPPFEKPSIEQGVNNFVQYKFSHLPSKERQTIVELAKMFLNRINYWHLETPSQRRQRS
PNDDVAGYKVNYTRWLCYCHVPQFCDSLPRYETTQVFGRTLLRSVFTVMRRQLLEQARQE
KDKLPLEKRTLILTHFPKFLSMLEEEVYSQSSPIWDPDFLTASSRASQLGIQTVINPPPV
ARTVSYNGSPSSLEQPIGGSMSPVCKVSSGLEGNRGEKRKMNDLHSLEEAKRPRVVGDIP
LELINEVMSTITDPAAMLGPETNFLSAHSARDEAARLEERRGVIEFHVVGNSLNQKPNKK
ILMWLVGLQNVFSHQLPRMPKEYITRLVFDPKHKTLALIKDGRVIGGICFRMFPSQGFTE
IVFCAVTSNEQVKGYGTHLMNHLKEYHIKHSILNFLTYADEYAIGYFKKQGFSKDIKVPK
TKYVGYIKDYEGATLMGCELNPRIPYTEFSVIIKKQKEIIKKLIERKQAQIRKVYPGLSC
FKDGVRQIPIESIPGIRETGWKPSGKERGKEPKDPDQLYSTLKNILQQVKSHQSAWPFME
PVKRTEAPGYYEVIRFPMDLKTMSERLKNRYYVSKKLFMADLQRVFTNCKEYNPPESEYY
KCANILEKFFFTKIKEAGLIDK
Download sequence
Identical sequences F7A3N9
ENSMODP00000032522 ENSMODP00000032522 XP_001380514.2.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]