SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000032610 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000032610
Domain Number 1 Region: 612-981
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 1.57e-107
Family Formin homology 2 domain (FH2 domain) 0.0000507
Further Details:      
 
Domain Number 2 Region: 35-169,236-399
Classification Level Classification E-value
Superfamily ARM repeat 2.13e-69
Family Diap1 N-terninal region-like 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000032610   Gene: ENSMODG00000011181   Transcript: ENSMODT00000034192
Sequence length 1068
Comment pep:known_by_projection chromosome:BROADO5:2:205529973:205593507:1 gene:ENSMODG00000011181 transcript:ENSMODT00000034192 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGNAAGSGDHPPAPATLPHKQPAAPKQPMPGAGELEERFNRVLNCMNLPPDKIQLLSQYD
SEKKWELICDQERFQVKNPPAAYIQKLRSYLETGGVSRKVTADWMTNLGFKRRVQESTQV
LRELEISLRTNHIGWVQEFLNEENQGLDVLLEYLAFAQCSVAYDMESTDNGTPSPEKSKP
LDQSVEDLGKGSPPSSSSSLSQGKGRHLTVRCPPSPRLNPAHSRKTLRNSRIVSQKDDVH
VCIMCLRAIMNYQVCGEKNRFERLMEYFRNEDSNIDFMVACMQFINIVVHSVENMNFRVF
LQYEFTHLGLDVYLERLRLTESDKLQVQIQAYLDNVFDVGALLEDTETKNAVLEHMEELQ
EQVALLTERLREAENESMAKIAELEKQLSHTRKDLDILRERHSECATMGTSQLPPEPKKV
PILTPVPVQPSALELKLEELEKKGLIQILRGPGGDITIEIIPVVVATPSDMMTPPTTSMT
ARAPDSSGTDLPPPATPPAASVGPLPPPPPPPLPPSPPSPGVTSPPHQETPPSAPPPPPP
LPGSLGLPPAPPLPGTSPAPPPPPPPPPGMNGTVPPPPPGGLPGAIGGLTTAPDSAVKAK
KPIQTKFRMPVFNWVALKPNQITGTVFTEINDEKVLQELDMSDFEEQFKTKSQGPSLDLN
ALKVKTTQKAPSKVTLIEANRAKNLAITLRKGNLSTDRICEAIETYDLQALSLDFLELLT
RFLPTEYELSLIGRYEKEQKPVEELSDEDRFMLRFSRIPRLSERMATLAFLGNFPDTAQM
LMPQLNAIIAASMSIKSSDKLRNILEIVLAFGNYMNSSKRGAAYGFRLQSLDALLEMKST
DRKQTLLHYLVKVIGEKYPKLTCFHADLHFLDKAGAVSLDSVLQDTRALQRGMELTRREF
MRQDDNPVLKEFLKVNSPSMEKLLADGKTAQEAYESVVEYFGENPKTTPPSTFFPVFSRF
VKAYKKAEQEIEQWKKQEASAQEAGAPIPGEGQPAEPKSPPKARRQQMDLISELKRKQQK
EPLIYESDRDGAIEDIITVLKTAPFTARTGKRTSRLFLEAGLSDESPL
Download sequence
Identical sequences F7E8D0
ENSMODP00000032610 ENSMODP00000032610

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]