SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000033322 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000033322
Domain Number 1 Region: 16-135
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 5.1e-44
Family Frizzled cysteine-rich domain 0.000000161
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000033322
Domain Number - Region: 224-473
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.011
Family Rhodopsin-like 0.02
Further Details:      
 
Domain Number - Region: 152-166
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.068
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000033322   Gene: ENSMODG00000006737   Transcript: ENSMODT00000034900
Sequence length 556
Comment pep:known_by_projection chromosome:BROADO5:8:236916165:236918027:1 gene:ENSMODG00000006737 transcript:ENSMODT00000034900 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LLQRSSGAAAASAKELSCQEITVPLCKGIGYNYTYMPNQFNHDTQDEAGLEVHQFWPLVE
IQCSPDLKFFLCSMYTPICLEDYKKPLPPCRSVCERAKAGCAPLMRQYGFAWPDRMRCDR
LPEQGNPDTLCMDYNRTDLTTASPSQPHHHHPPPPPPPLPGEQPPPGSGHHRPSGGGKSR
TPGGGSSPCEPGCQCRAPMVSVSSERHPLYNRVKTGQIANCALPCHNPFFSQDERAFTVF
WIGLWSVLCFVSTFATVSTFLIDMERFKYPERPIIFLSACYLFVSVGYLVRLVAGHEKLG
AVEQHVRYETTGPALCTVVFLLVYFFGMASSIWWVILSLTWFLAAGMKWGNEAIAGYSQY
FHLAAWLVPSVKSIAVLALSSVDGDPVAGICYVGNQSLDNLRGFVLAPLVIYLFIGTMFL
LAGFVSLFRIRSVIKQQGGPTKTHKLEKLMIRLGLFTVLYTVPAAVVVACLFYEQHNRPR
WEATHNCPCLRDLQPDQARRPDYAVFMLKYFMCLVVGITSGVWVWSGKTLESWRALCTRC
CWASKGAGPGGGAAAA
Download sequence
Identical sequences F6UJW9
ENSMODP00000033322

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]