SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000033497 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000033497
Domain Number 1 Region: 258-327
Classification Level Classification E-value
Superfamily Homeodomain-like 4.28e-20
Family Homeodomain 0.0000347
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000033497
Domain Number - Region: 51-61,200-255
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0107
Family Formin homology 2 domain (FH2 domain) 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000033497   Gene: ENSMODG00000004459   Transcript: ENSMODT00000035074
Sequence length 450
Comment pep:known_by_projection chromosome:BROADO5:3:431666783:431752536:1 gene:ENSMODG00000004459 transcript:ENSMODT00000035074 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDDPSRLLAAAAAAAAAAATHPVGALSGIPPLPLPPPDAEELEPAAPHRLPPPPGPPPPA
PGPGPHQDTGDILQQIMAITDQSLDEAQARKHALNCHRMKPALFSVLCEIKEKTVLSIRG
IKEEDPPDAQLMRLDNMLLAEGVSGPEKRGRGGPSAVAATSGGCPNDNSIEHSDYRAKLS
QIRQIYHSELEKYEQACSEFTTHVMNLLREQSRTRPISPKEIERMVNIIHGKFSTIQMQL
KQSTCEAVMILRSRFLDARRKRRNFSKQATEVLNEYFYSHLSNPYPSEEAKEELAKKGGI
TVSQVSNWFGNKRIRYKKNMGKFQEEANIYAAKTAVDATTVVAQGNQANSPSTPSSGSSG
SFKMTNSGDSFINLQSLTYQSSPVGASVQSQMDSLHHVIHQTGRYDSLVGNPLYTTQRID
TNGSWQDATTPSSITSPAGDPGSVNSDASN
Download sequence
Identical sequences F6WGN9
XP_007488655.1.35504 ENSMODP00000033497 ENSMODP00000033497

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]