SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000033527 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000033527
Domain Number 1 Region: 241-314
Classification Level Classification E-value
Superfamily Homeodomain-like 2.1e-26
Family Homeodomain 0.00072
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000033527
Domain Number - Region: 154-163
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.00243
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000033527   Gene: ENSMODG00000004356   Transcript: ENSMODT00000035105
Sequence length 358
Comment pep:known_by_projection chromosome:BROADO5:8:215754630:215778702:-1 gene:ENSMODG00000004356 transcript:ENSMODT00000035105 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQRPGGGSGAGGSGGGSGGSQGTAFSIDSLIGPPPPRSGHLLYTGYPMFMPYRPLVLPQA
LAPAPLPAGLPPLAPLASFAGRLTNTFCAGLGQAVPSMVALTTALPSFAEPPEAFYGPPE
LAASRNNPEPSGRRPESGLESDELPPTREKVAEPPPPPPPPAPHFSETFPSLTAEGKVYS
SDEEKLDAPSGEAAGSEPEEEGSGGGDSEDDSFLDSATGGAAALLGPKAKLKGSLGAGAL
DGPPGAPGASAPGGKSRRRRTAFTSEQLLELEKEFHCKKYLSLTERSQIAHALKLSEVQV
KIWFQNRRAKWKRIKAGNVSSRSGEPVRNPKIVVPIPVHVNRFAVRSQHQQLEQGARP
Download sequence
Identical sequences F6T3S9
XP_007504685.1.35504 XP_007504686.1.35504 ENSMODP00000033527 ENSMODP00000033527

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]