SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000034615 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMODP00000034615
Domain Number - Region: 138-148
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.000207
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 
Domain Number - Region: 630-808,869-965,1053-1108,1194-1234,1275-1431,1468-1516
Classification Level Classification E-value
Superfamily ARM repeat 0.00046
Family MIF4G domain-like 0.077
Further Details:      
 
Domain Number - Region: 472-578
Classification Level Classification E-value
Superfamily ARM repeat 0.0102
Family Armadillo repeat 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000034615   Gene: ENSMODG00000007320   Transcript: ENSMODT00000036203
Sequence length 1834
Comment pep:known_by_projection chromosome:BROADO5:3:358015670:358101166:-1 gene:ENSMODG00000007320 transcript:ENSMODT00000036203 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAVDSAMELLFLDTFKHPSAESSHIDVVRFPCVVYINEVRVIPPGVRAHSSLPDNRAYGE
TSPHTFQLDFFFNNVSKPSAPVFDRLGSLDYDENTSIIFRPNSKVNTDGLVLRGWYNCLT
LAIYGSVDRVISHDRDSPPPPPPPPPPPQQQPSVKRTPKHADSEKEEQFNGSPPRPQPRG
PRTPPGPPPPDDDDDDEEPLPVPVVGEKEDDAPQREDYFEPISPDRTSVHQEGQYSDEGE
VEEDQHEEGEDEEEDADVEEEEDEDEEDGHTVESIPEEEEDEEEEEEEGEEEGEEEEEEE
EEGEGEDEEEEGEGDDGYEQISSDEDGIADLERETFKYPNFDVEYTAEDLASVPPMTYDP
YDRELVSLAYFSCPYKTTFEIEVNRMKEQGPDKENSGAVEASVKLLELLELYQEDRGAKW
VTALEEVPSLIVKGLSYLQFKNTQQDYIGQLVDWTMQALNLQVALRQPIALNVRQLKAGT
KLVSSLAECGPQGVMGLLQAGVISGLFELLFADHVSSSLKLNAFKALDSIISMTEGMEDF
LRGRQDLHEKSGYQKLLELILLDQTVRVVTAGSAILQKCHFYEILSEIKRLGDQLAERSS
IPNHSESEQDTDPGLERTNPDYENEVEASLDIVHLLESSLITEGEIEKLINLLDEIFHLM
ETAPHTMIQPPVKSFPTIARITGPPERDDPYPVLFRYLHSHHFLELVTLLLSIPAISAHP
AVLQAMRDVLKFLTQSQKGLLFFLSEHEATNLLIRALCHLLDQEEEDGLQSDGVIDDTFA
LWLQYSTQTLQFITELFCHFQHCTNNEETDHSDLLGTLHNLYQITFNPVGRAAVGHVFSL
EKNLQSLITLMEYYSKEALGDSKSKKSVAYNYACILVLLVVQSSSDVQMLEQHAAPLLKL
CKADENNTKLQELGKWLEPLKNLRFEINCIPNLIEYVKQNIDNLMTPEGVGLPTALRVLC
NIACPPPPVEGQQKDLKWNLAVIQLFSAEGMDTFIRVLQKLNNILTQPWRLHVNMGTTLH
RVTTISMARCTLTLLKTMLTELLRGGSFEFKDMRVPSALVTLHMLLCSIPLSGRLDSDEQ
KIQNDIIDILLTFTQGVNEKLTISEETLANNTWSLMLKEVLSSVLRVPEGFFSGLILLSE
LLPLPLPMQTTQVIEPHDISVALNTRKLWSMHLHVQAKLLQEIVRSFSGTTCLPIQHMLR
RICVQLCDLASPTALLIMRTVLDLIVEDMQSNSEDKEKQYTTQTTRLLALLDALASHKAC
KLAILHLINGTIKGDEKYAEIFQELLALIRSTGESVIHQQCVEYVTSILQSLCDQDIALI
LPSSSEGSLSELEQLSNSLPNKELMASICDCLLETIASSENSYNCLLTCVRTMMFLAEHD
YGFFHLKSSLRKHSNSLYRLLKRVVNTFSKDTGELTSSFLEFMRQILNSDTMGCCGDDSG
LMEVDGSHPSRTLSLNAAELKQLLQSKEESPESLFLQLEKHVLEHSKDDDNLDSLQDNIV
GLRQMLESAGDPLPLSDQDVEPVLSAPESLQNLFNNRTAYVLADVMDDQLKSMWFSPFQS
EEIETDLDLVKVDLIELSEKCYSDFDLQAELERSFLSEPSSPGRTKTTKGFKLGKHKHET
FITSSGKSEYIEPAKRAHIVPPPRGRGRGGFGQGIRPHDIFRQRKQNTSRPPSMHVDDFV
AAESKEVVPQDGLPPPKRPPKVSQKISSRGGFSGNRGGRGAFHSQNRFFTPPASKGNYSR
REGTRGSSWSAQSTPRGTYNESRGGQSNFSRGPLPPLRPLSSAGYRPSPRDRASRGRGGL
GPSWASANSGSGGSRGKFVSGGSGRGRHVRSFTR
Download sequence
Identical sequences F7CD60
ENSMODP00000034615 ENSMODP00000034615

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]