SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000034977 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000034977
Domain Number 1 Region: 159-267
Classification Level Classification E-value
Superfamily Acid proteases 1.83e-20
Family Retroviral protease (retropepsin) 0.0003
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000034977
Domain Number - Region: 43-135
Classification Level Classification E-value
Superfamily dUTPase-like 0.000785
Family dUTPase-like 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000034977   Gene: ENSMODG00000024650   Transcript: ENSMODT00000036565
Sequence length 269
Comment pep:novel chromosome:BROADO5:1:143539926:143723711:1 gene:ENSMODG00000024650 transcript:ENSMODT00000036565 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LRRDTPPPVPDERLQVSAPNAERAGTGLPPLSPGANQGRTMRYSFRFPIIATESIVLKEN
SEPTWIPASFRFPVPQGAKGLILGDPDLIAKGLEIFPTLFQDKETNGLHILAAAKTDFCI
SKDNNLAYLTIFPEADFSLKSKLQKSSLDSTAHGLFWSQKVTQDRMIMSLFVEDRVISGI
LDSGADISVISATDWPESWEVIEPHQKLVGIGTPEHILKSANTLSWSDSEGHRGTFKPYV
LDIAQSLWGREVMSAMNITLTTSDRLHTE
Download sequence
Identical sequences F6XBD0
13616.ENSMODP00000034977 ENSMODP00000034977 ENSMODP00000034977

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]