SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000035173 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000035173
Domain Number 1 Region: 53-170
Classification Level Classification E-value
Superfamily PH domain-like 2.91e-41
Family Enabled/VASP homology 1 domain (EVH1 domain) 0.00000154
Further Details:      
 
Domain Number 2 Region: 804-842
Classification Level Classification E-value
Superfamily Vasodilator-stimulated phosphoprotein, VASP, tetramerisation domain 0.00000000000471
Family Vasodilator-stimulated phosphoprotein, VASP, tetramerisation domain 0.0017
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000035173
Domain Number - Region: 621-631
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0022
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000035173   Gene: ENSMODG00000005856   Transcript: ENSMODT00000036763
Sequence length 844
Comment pep:known_by_projection chromosome:BROADO5:2:137209733:137462631:-1 gene:ENSMODG00000005856 transcript:ENSMODT00000036763 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDLKHTSQKTRNFQQEDPEAGGPSHAKAGEIWTLPIFHFMINAVTCPDSTGSSEQSICQA
RAAVMVYDDANKKWVPAGGSAGFSRVHIYHHSGNNTFRVVGRKIQDHQVVINCAIPKGLK
YNQATQTFHQWRDARQVYGLNFGSKEDANVFASAMMHALEVLNSQEAAQSKVTATQDSTN
LRCIFCGPTLPRQNSQLPSQVQNGPSQEELEIQRRQLQEQQRQKEMERERLERERMERER
LERERLERERLERERMEQEQLERERQERLERERQDRERLERERQERERQEQLEREQLEWE
RERRISNAAPSFDNSLYSAPLPEYSSCQPPSAPPPSYAKVISAPVSDATPDYAVVTSVPP
TSTPPTPPLRHSATRFATSLGSAFHPVLPHYATVPRPLNKNSRPSSPVNAPPSQPPATKP
FAWSASNFAPLPPSPPVMISSPPGKATGPRPVLPVCVSNPLPQMPPSPTAPNGLPDSVTY
PAPSPSTSGPAAPPPPPPPPAPPLPSLPSLSHSGPQASPPPSTPIASTPSSKPSVLPSPS
AAAPASVETSLNSVLGDSSASEPTLQAASQPIETPTQQGIVLGPPAPPPPPPLPPGPTQT
SVTLPPPPGPPPAPPLPSSGPPPPPPPPPLPNQAPLPVPLPPPAPPLPPSGFSVAYVSED
NRPLTGLAAAIAGAKLRKVSRIEDSSSPSGGSAIGVNSTSAKTDTGRGNGPLPLGGSGLM
EEMSALLARRRRIAEKGSTIETEPKEDKTEDAEPSASKTSSSTPEPTRKPWERTNTMNGS
KSPVISRPKSTPSAQPSANGVQSEGLDYDRLKQDILDEMRKELTKLKEELIDAIRQELSK
SNTT
Download sequence
Identical sequences F7FCN6
ENSMODP00000035173 ENSMODP00000035173 XP_007481546.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]