SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000035775 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000035775
Domain Number 1 Region: 562-603,672-724,759-791
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000000000261
Family Nucleotide and nucleoside kinases 0.0076
Further Details:      
 
Domain Number 2 Region: 1431-1562
Classification Level Classification E-value
Superfamily EF-hand 0.00000251
Family Calmodulin-like 0.02
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000035775
Domain Number - Region: 4-107
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.00042
Family Calponin-homology domain, CH-domain 0.01
Further Details:      
 
Domain Number - Region: 889-898
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.00445
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 
Domain Number - Region: 1042-1087
Classification Level Classification E-value
Superfamily Type III secretion system domain 0.0549
Family TyeA-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000035775   Gene: ENSMODG00000020370   Transcript: ENSMODT00000037360
Sequence length 1792
Comment pep:known_by_projection chromosome:BROADO5:3:240501499:240776527:-1 gene:ENSMODG00000020370 transcript:ENSMODT00000037360 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSDILCRWLNQEVKLSRTVSSKGIEKDFSNGFLLGELLHKYELQDDFPLFSEGRVSNAKL
NNFSRLEPTFQLLGVQFDQNVAQNIMTEKHGSVTILLYQLYIALQKKRKSGLTGVAMQTM
RPLAPAKLQTMRSEIYRERLKNLVPRQTDLNLSRVSEKFEAKYKKMEEKIARVHFQNIRK
FEKFQEEQRIQDLEKQRLGRRRQHEMMARIQAAILQIPKTVPNRTLKSIESHKMMMKKKE
EEDVLNEIQKFEMLIKKELEAKGSGSKVPSAAQTTADLLSTYSDEEYIKKIQKRLEEDTL
AREQREKRRRKLLMDQLIAHEAQEEAYREEQLINRLMRQSQQERRIAVQLMHVRHEKEVL
WQNRVFREKQYEERRLKDFQDALDREAALARQAKLEYEEQAQKEIEIHERIAAERSQARY
KKHYSMCTEILDNIIDLSTKIAEYRELTHNLIPVKIMRDWKELFFSGKPIYEIASIDSKP
SRFTSEQLIELSKRNLLDDNDYEEYKNLTGEWVLPEDMADVPLPSNNNILGHVIRVVHEK
VYPPKPAYIATQLPSSSIKGCMLGKTCSGKTSCLKILEEVFHIEILCMDTLVQEAIQAFL
RNETVTEVETHKEDLSKEVQDIKDSNMTTIAEIIPTEEKKDENLPQQDEVIIKPPSAQDV
RIRLTNRAQLGSKCEKLLKRGRSIPDVLLIQIMVNAINEISSDKGWILDGFPMTINQAKL
LEEALTGFNTDQPEHEIKAHKKSTLVFDPSAPKDPPPPPPAFDFVMLLDITDTLVLNRVM
GEEKRNTDTTGIPESATSEMFPEEQEKFELLRDQIQHRILGFLDNWPELEKWFSGKQDIL
ITVNAEVDKRALATKLQELFIAELRKKEAKAKQELEEQEEERKKKEALPPEPPPPPPPEP
EEEPKEAKGKGKGKGKGAKEGKGKKDTSPKGKDAAKEAKAKKSETSPKGKGRSPDKRSPE
DKTSPPAPPGPPPVKAGSEDWVYVDEPLPQEIFEYLDTFWEVIESSYINTSKAIFRQIRD
ERHSVLYYLHNVRLNYQGYLKRPDHKQEFVSQWQEDFNNLPEDLWEDEETKAELHQRVND
LRDRLWDICDTRKEEAEQERADIIDESWLQDHLGILMNHFFSLMQVELSRFQDIKTFLQD
YYRGMEGKIPTDLAKSGYTRVPLIDLDEEDTDITSKIPLSEEEEEEKKELTPHQKIPVIP
RRQPSPEGLLNKPRSKLSLRGGRPDYCLENVQLKFERDEKTLMTIWQNTSSAINLLVNSE
IQLRKLEDDKENKPTSTKEKSPQDGGKGPKGAKKKPDKKKVPSPVEAVSMVLTPEEQEAL
DKRNELKMKIKEEHITALQCEAQASIFRLELIKMKALSYMEELLGRAVEVYKLMDKWLGA
RYLAEMASVEKLTEVAHYHIETSTRIQNELILNEEDFYINGDVKVFPDPLPPVRPPPVEK
EMNTFLTLEQLNTLRNEFLQMAPKGYLGSKHFTDILSDLVTLNLGTNHIPKAWLHLILSE
LQELTSLLVVNSEFVDWRRFLLVVSQPWPLPSEEELLETLNRFKAIDEDEKGTVTWEQYE
QVGLWFTGDLNIEVPEDPNEPLPYNRPAHLIMFFFDLFADFQKDPPELDYLNMLLYFACH
PNPVEGVYRALSLAIGTHVFRKYETIAVPMEYVTPAYYTDTTIEELPEVEEVVKEDKEKI
IVPEFSNKETISIPMLLKIFQRKKETQDNHRFFEEEKQENVFSEVFQKVYRVVGSKNLEP
VEVAVLLKHPFMQDLISTYKEYKFPDIKGILQRVDQLQVLTNGDQKTTEEKK
Download sequence
Identical sequences F7AB98
ENSMODP00000035775 ENSMODP00000035775

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]