SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000035948 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000035948
Domain Number 1 Region: 170-211
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000000311
Family Variant RING domain 0.021
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000035948
Domain Number - Region: 103-113,221-227
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0102
Family Formin homology 2 domain (FH2 domain) 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000035948   Gene: ENSMODG00000015546   Transcript: ENSMODT00000037537
Sequence length 415
Comment pep:known_by_projection chromosome:BROADO5:7:176807008:176939975:1 gene:ENSMODG00000015546 transcript:ENSMODT00000037537 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLMPLSGFLWWWWCCCCCWYCCGGCYQAPQMFRHQGLLKCRCRMLFNDLKVFLLRRPPPA
PLPMHGDPQPPGLAANNNTLPALGAGGWVGWRGPREGTGGEIPPLPPPPPLPPSSAEDDW
GGQVVDPPASLLSSTSSDDFCKGKAEDRXXXXXXXXXXXFLIASLALSLQGELLSPCRCD
GSVKCTHQPCLIKWISERGCWSCELCYYKYHVIAISTKNPLQWQAISLTVIEKVQIAAAI
LGSLFLIASISWLIWSTFSPSAKWQRQDLLFQICYGMYGFMDVVCIGLIIHEGPSVYRIF
KRWQAVNQQWKVLNYDKTKDIEDQKAGGRTNPRTSSSTQADAASSEEEAVGNPAQGDGGG
SGGGGGNRAPSHPSGPLADHHCAYTILHILSHLRPHEQRSPTGGNRELVMRVTTV
Download sequence
Identical sequences F6ZIZ5
13616.ENSMODP00000035948 ENSMODP00000019403 ENSMODP00000035948

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]