SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000036030 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000036030
Domain Number 1 Region: 130-264
Classification Level Classification E-value
Superfamily Acid proteases 1.9e-43
Family Retroviral protease (retropepsin) 0.0000693
Further Details:      
 
Domain Number 2 Region: 8-139
Classification Level Classification E-value
Superfamily dUTPase-like 1.96e-23
Family dUTPase-like 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000036030   Gene: ENSMODG00000024884   Transcript: ENSMODT00000037619
Sequence length 283
Comment pep:novel chromosome:BROADO5:6:90632153:90633004:1 gene:ENSMODG00000024884 transcript:ENSMODT00000037619 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EPLSSSLTRATAGSAGLDLCASITRILTPEEGPIILPTGKFGPPPPGMFFLVIGRALTTL
QGVVVHPTLVDNDYTGEIKIIIESPHGPVTIPAGKRLAQALPLPMIGNFPAVAYTRGPSS
PGSSNIYWVQQLTESRPTLKLKIEGKTFTGLLDTGADSTVISQAHWPRSWPLQPSSTHLS
GIGQVQDTLQSSKILTWQDTEGNRGTTRPYVVAGLPVNLWGRDILAQMRLLMVSPSDPVT
TMMLKSGYLPGKGLGKREQGLPHPISFRPHKDREGLGLQSFCS
Download sequence
Identical sequences F6SHN3
13616.ENSMODP00000036030 ENSMODP00000036030 ENSMODP00000036030

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]