SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000036107 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000036107
Domain Number 1 Region: 121-255
Classification Level Classification E-value
Superfamily Acid proteases 4.22e-40
Family Retroviral protease (retropepsin) 0.0000801
Further Details:      
 
Domain Number 2 Region: 2-131
Classification Level Classification E-value
Superfamily dUTPase-like 5.89e-20
Family dUTPase-like 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000036107   Gene: ENSMODG00000024894   Transcript: ENSMODT00000037696
Sequence length 271
Comment pep:novel chromosome:BROADO5:2:83536091:83536903:-1 gene:ENSMODG00000024894 transcript:ENSMODT00000037696 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ATAGSTGLDLCASTTRILTPEEGPIVLPTGKFGPPPPAMFFLVIGRAPTTLQGVVIHPTL
VDNDYTGEIKIIIESPHGPVTIPVGRRLAEALPLPMIGNFPAVAHTRGPSSPGSSNIYWV
QQLTKSRPTLRLNIEGKTFTGLLDTGADSTVISQAHWPRSWPLQPSSTHQSGIGQVQDTL
QSSKILNWQDTEGNSGTTRPYVVTGLPVNLWGRDILAQMRLLMVSPSDPVTTMMLKSGYL
PGKGLGKREQGLSYPISFQPHKNREGLGLQS
Download sequence
Identical sequences F6XS70
ENSMODP00000036107 13616.ENSMODP00000036107 ENSMODP00000036107

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]