SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000036812 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000036812
Domain Number 1 Region: 124-258
Classification Level Classification E-value
Superfamily Acid proteases 2.88e-39
Family Retroviral protease (retropepsin) 0.00006
Further Details:      
 
Domain Number 2 Region: 2-133
Classification Level Classification E-value
Superfamily dUTPase-like 3.79e-25
Family dUTPase-like 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000036812   Gene: ENSMODG00000025081   Transcript: ENSMODT00000038408
Sequence length 274
Comment pep:novel chromosome:BROADO5:3:115075491:115076312:1 gene:ENSMODG00000025081 transcript:ENSMODT00000038408 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LARATTGSAGLDLCSSSNRILTPEDGPEVISTGVTGPPPPGMFFLIIGRALTTLQGVVVH
PTLVDNDYTGEIKLIVESPHGPVTIPAGHRLAQALPLPMVGDFPTIEQTRGPSSPGSSNI
YWAQQITESRPTLQLSLDGKKFIGLLDTGADSTVISHKHWPCAWPLQPSTTHLSGIGQVN
HTLQSSKFLTWRDAEGNTGTTRPYIVKGLPVNLWGRDILAQMRLLMVSPSDPVTQMMLKS
GFLPGKGLGKNEQGDPQPISLTPNRDKAGFGSQN
Download sequence
Identical sequences F6VPV3
ENSMODP00000036812 13616.ENSMODP00000036812 ENSMODP00000036812

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]