SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000036821 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000036821
Domain Number 1 Region: 130-260
Classification Level Classification E-value
Superfamily Acid proteases 2.39e-39
Family Retroviral protease (retropepsin) 0.00012
Further Details:      
 
Domain Number 2 Region: 8-140
Classification Level Classification E-value
Superfamily dUTPase-like 1.23e-23
Family dUTPase-like 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000036821   Gene: ENSMODG00000025086   Transcript: ENSMODT00000038416
Sequence length 279
Comment pep:novel chromosome:BROADO5:3:113593762:113594601:-1 gene:ENSMODG00000025086 transcript:ENSMODT00000038416 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EPLSNSLTRATAGSAGLDLCASTTRILTPEEGPIILPTGKFRPPPPGMFFLVIGRALTTL
QGVVVHPTLVDNDYTGEIKIIIESPHGPVTIPSGKRLAQALPLPMIGNFPAVAHTRGPSS
PGSSNIYWVQQLTESRPTLQLKIEGKTFTGLLDTGADSTVISQAHWPLQPSSTHLSGIGQ
VQDTLQSSKILNWQDTEGNRGTTRPYVVAGLPVNLWGRDILAQMRLLMVSPSDPVTTMML
KSGYLPGKGLGKREQGLPHPISFRPHKDRKGLGLQSFCS
Download sequence
Identical sequences F6VP94
ENSMODP00000036821 13616.ENSMODP00000036821 ENSMODP00000036821

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]