SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000037206 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMODP00000037206
Domain Number - Region: 92-197
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0314
Family Formin homology 2 domain (FH2 domain) 0.011
Further Details:      
 
Domain Number - Region: 103-139
Classification Level Classification E-value
Superfamily Outer membrane lipoprotein 0.0447
Family Outer membrane lipoprotein 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000037206   Gene: ENSMODG00000025156   Transcript: ENSMODT00000038805
Sequence length 324
Comment pep:novel chromosome:BROADO5:7:72129471:72245629:1 gene:ENSMODG00000025156 transcript:ENSMODT00000038805 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIIRNQRIKRIQNKDHVPMADCGKETRTSSELSATKKKKETTIDSYYSANGIEGERSPND
KPEILANWIQAVEELKTQLRKAEDNWEKNLKSMLSHLETEALELKQENSVLKAKINQLEN
EAKEMKDEAKEMKDEVKRMKDDLQRKSDQKEKDDQKARDEIQSLRTRIKQLESNLENMSR
RDNLRIITLPEDHDKRKSLGIILHEIIQERCPYILEQERTVEIERIHRSPPLINPKLTTT
RNEYYSQVPGSQPNDKKLQIPRRKQFRYHRTTVSITQDLTASTIKDQKTYNIFQKAKELS
LQPRITYLAKLSITYKGEKWSFNE
Download sequence
Identical sequences F7GHX4
13616.ENSMODP00000037206 ENSMODP00000037206 ENSMODP00000037206

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]