SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000039702 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000039702
Domain Number 1 Region: 119-222
Classification Level Classification E-value
Superfamily E2F-DP heterodimerization region 6.8e-32
Family E2F dimerization segment 0.0017
Further Details:      
 
Domain Number 2 Region: 40-104
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.5e-17
Family Cell cycle transcription factor e2f-dp 0.0000427
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000039702
Domain Number - Region: 12-35
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.0889
Family beta-sandwich domain of Sec23/24 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000039702   Gene: ENSMODG00000005958   Transcript: ENSMODT00000042808
Sequence length 343
Comment pep:known_by_projection chromosome:BROADO5:3:145825583:145874900:-1 gene:ENSMODG00000005958 transcript:ENSMODT00000042808 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAAAELGSSGQQQPPGQGQPPQQPPAAPPGNGGGGSSSRHEKSLGLLTTKFVSLLQEAK
DGVLDLKAAADTLAVRQKRRIYDITNVLEGIDLIEKKSKNSIQWKGVGAGCNTKEVIDRL
RYLKAEIEDLELKERELDQQKLWLQQSIKNVMDDSINNRFSYVTHEDICNSFNGDTLLAI
RAPSGTQLEVPIPEMGQNGQKKYQINLKSHTGPIHVLLINKDSSSSKPVVFPVPPPDDLT
QPPSQVSTPVSPQKPNTETQNLPEQHTLTIGQHLQQTPVSDTPSDYNSQQGSTAPSAPHS
SHPDSVLYTSLAIDVTQTSTNSNEYPSLLPLDVNCILKPNSLI
Download sequence
Identical sequences K7E1Q1
ENSMODP00000039702

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]