SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000039721 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMODP00000039721
Domain Number - Region: 329-334
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0131
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000039721   Gene: ENSMODG00000017255   Transcript: ENSMODT00000044081
Sequence length 628
Comment pep:known_by_projection chromosome:BROADO5:2:421768628:422042062:1 gene:ENSMODG00000017255 transcript:ENSMODT00000044081 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDNAVDGLDKASIANSDGPTTGSQTPPFKRKGKLSSIGKIFKPWKWRKKKTSDKFRETSA
VLERKISTRQSREELIRRGVLKELPDQDGDVTVNFENSNGHMISIGEEATQEENIVKSEE
GNGSLSEKATSVEEKAEDKKENPENHSETPAHPVPAPPKPKPKPKPKKPAAPPKGAAALQ
ASHKGDEAPPNKKTTKAPGKQPPIPPPKPTSRGVNREVASSSHLKKTAVSKSSSSPSTST
TSSRSKASKEPTSSKTAAAGTSRGKKKAGKQSTPRPPSEKAVSATSNLKGEPLETRVENL
KSDPSLPTSEEQNTDIQNKSVVPPPPVAPPPPPPAPPLPLENQSINVSDIPAVTISDGAS
LSVSALDSSHPKTEEVTDRTTLSSDTSLGVNRENTKCLTTKEELIKDAPRLMIPVLMGES
SESLSSTEIEVRRENQANDSDSDGPILYTDDDDDDDDEDDSSESALASKIRRRDTLAIKL
GNRPSKKELEDKNILQRTSEEERQEIRQQIGTKLVRRLSQRPTSEELEQRNILKQKNEEE
EQEAKMELKRRLSRKLSLRPTVAELQARRILRFNEYVEVTDSPDYDRRADKPWARLTPAD
KAAIRKELNEFKSTEMEVHEESRQFTRW
Download sequence
Identical sequences K7E1S0
ENSMODP00000039721

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]