SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000040328 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMODP00000040328
Domain Number - Region: 98-175
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.051
Family Formin homology 2 domain (FH2 domain) 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000040328   Gene: ENSMODG00000029787   Transcript: ENSMODT00000043433
Sequence length 618
Comment pep:known_by_projection chromosome:BROADO5:3:85723869:86269350:-1 gene:ENSMODG00000029787 transcript:ENSMODT00000043433 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADMTAVTGSGVEAYWSRDLSDEEHAVLHIEGISAARNSRARSKLKFPKPDVKLKASKST
DTSIPMDPFKGAGDSTCKEIVHNGGMKSASLKDLCPEDKRRIANLIKELARVSEEKEVTE
ERLKAEQESFEKKIRKLEEQNELIIREREALQQQYRECQELLKLYQKYLSEQQEKLTLSL
SELGTGKVKEQQQVPIRKNSPDSPHQEENDAYRNLTSSQNYQNKNEPKFASQSSAPETNP
CFESYSHRIADLQRPQDGLNREQTEARICNLKSPGTRLMGSILTKRTLPNEMRNKEFSHL
PPYVGGYCRVQGYPENEEPVHRSHQAGMTRHHPRTHHCESCSYCGLSWIPCEPVTLGHEE
MDDKKQMPVERRKQLLLQKMELEIEKERLQHLLTSQETQLLLKQQQLFQSRLDYSRLKRQ
AAFNSRDIAIDGEALSKKDLNLSMNGIGTGLSFLQSKPDDYLHRTPTPSKGIKLHSTTEE
GNSIGKKPIGFRSNVKEDDLWMYRPNDTNRSRRGEMSRARKDATTSPIMPVTRKDFVTTA
TSPFQCDTARYNTSLLDLVHSLSPRSASRPRPPLSREAYAWNHSPVQVFPRKLAWASRAS
GQCEELEESRMLEEIFFI
Download sequence
Identical sequences K7E3H6
ENSMODP00000040328 XP_007486797.1.35504 ENSMODP00000040328

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]