SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000040367 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000040367
Domain Number 1 Region: 226-375
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 1.45e-42
Family Reverse transcriptase 0.00014
Further Details:      
 
Domain Number 2 Region: 119-229
Classification Level Classification E-value
Superfamily Acid proteases 5.63e-21
Family Retroviral protease (retropepsin) 0.00027
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000040367
Domain Number - Region: 5-93
Classification Level Classification E-value
Superfamily dUTPase-like 0.0166
Family dUTPase-like 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000040367   Gene: ENSMODG00000028361   Transcript: ENSMODT00000043473
Sequence length 375
Comment pep:novel chromosome:BROADO5:2:423473045:423474305:-1 gene:ENSMODG00000028361 transcript:ENSMODT00000043473 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRYSFRFPIIATESIVLKENSEPTWIPASFRFPVPQGAKGLILGDPDLIAKGLEIFPTLF
QDKETNGLHILAAAKPAFCISKDNNLAYLTIFPEADFPLKSKLQKSSLDSTAHGLFWSQK
VTQDRMVMSLFVEDRVISGILDSGADISVISATDWPESWEVIEPHQKLVGIGTPEHILQS
ANSLSWSDSEGHRGTFKPYVLDIAQSLWGREVMSAMNITLTTSDKLHTEFVGAASVAPLF
ADPITWLSSKPIWINQWPISKEKLVHLEAIIQEQLRLGHIRESNSPWNTPIFLVPKKAGK
WRLVHDLRKINEQLMDMGTRQPGLPSPGPIPINWKLIVIDLKDCFFNIRLSPQDCHRFAF
SVPSINYGTPFKRFE
Download sequence
Identical sequences K7E3L5
ENSMODP00000040367 ENSMODP00000040367

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]