SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000040471 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000040471
Domain Number 1 Region: 3-126
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 2.67e-22
Family Reverse transcriptase 0.0000344
Further Details:      
 
Domain Number 2 Region: 179-292
Classification Level Classification E-value
Superfamily Ribonuclease H-like 2.28e-20
Family Ribonuclease H 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000040471   Gene: ENSMODG00000027756   Transcript: ENSMODT00000043578
Sequence length 296
Comment pep:novel chromosome:BROADO5:5:241545677:241546728:1 gene:ENSMODG00000027756 transcript:ENSMODT00000043578 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSALSELKKAILSAPALGIPNYNKPFTLYVHERRGVASGVLTQTLGPSQRPVAYYSAQLD
PIASGAPPCLRGVAATALLVTKTVDLVLGCPLTIMCPHEVEALLLRQRTQAFSDQRITRY
EITLLNNENITLKRCSTLNPATLLPDLPTSGEPLHSCETLVSMAEKPRDDLLDTPLKNSD
LILFTDGSSFMRDGIRYSGAAVVSEFATEWSASLPSNISAQGAELIALKHACIIAKDKKA
TIYTDSRYAFGICHSVGMLWLQRGFLTSAGKSIANAEIINEVLSALQLPEALAVVH
Download sequence
Identical sequences K7E3W9
ENSMODP00000040471 ENSMODP00000040471

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]