SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000040556 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000040556
Domain Number 1 Region: 104-194
Classification Level Classification E-value
Superfamily SAND domain-like 2.44e-29
Family SAND domain 0.001
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000040556
Domain Number - Region: 38-103
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.00201
Family beta-sandwich domain of Sec23/24 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000040556   Gene: ENSMODG00000029151   Transcript: ENSMODT00000043661
Sequence length 274
Comment pep:novel chromosome:BROADO5:4:384467292:384482605:1 gene:ENSMODG00000029151 transcript:ENSMODT00000043661 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GDGHDSLNQRQVSLSEFLKKEVAAAAIPIPVPVPLTGPPRRGYEPLFAPPPQPPPPPPPP
PPPPHLHLHPPRAYLSLPRAHRPLPLPPDELALERFSAAPDFQPFLDHGEPCIEVECGDN
RALLYVHKLCQGSKGPSIRYRGEWLTPNEFQFVSGRETAKDWKRSIRHKGKSLKTLMSKG
ILQVHPPICDCAGCRISSPVNRGRLAEKRTIPLPPTRIPKKELSSIFSASDGDSDGSSPA
HGHRPDVKQEDDLHISIMKRRHILSHTCAGKPGG
Download sequence
Identical sequences K7E454
ENSMODP00000040556 ENSMODP00000040556

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]