SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000040616 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMODP00000040616
Domain Number - Region: 21-30,113-135
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.00207
Family Formin homology 2 domain (FH2 domain) 0.085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000040616   Gene: ENSMODG00000029622   Transcript: ENSMODT00000043723
Sequence length 259
Comment pep:novel chromosome:BROADO5:1:42456077:42487219:-1 gene:ENSMODG00000029622 transcript:ENSMODT00000043723 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQALAAPKPAAPAPPPAAAAPPPPPPPAPPGGPHLYEELGGSAMYEMPQYGSRRRLLPPA
GEEYGEVAGEAEEEYYPEEEWARKKMIQLAVDREYETSSAGEDSAPECQRTCLHNPQIHN
NVNGNIYIAQNGSVVRTRRVCLTNNLKVPSPVKMGKHFKKLDKLAVTHEESVPLNTLSKG
AFSSEKLNTRPPLVSFAPGPMGVDSSAGKLGGGRIKSTAEQESRMDSQDMKGVLEFPSDH
TQSDDEELWMGPWNISTYQ
Download sequence
Identical sequences K7E4B4
ENSMODP00000040616 ENSMODP00000040616

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]