SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000040669 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000040669
Domain Number 1 Region: 249-608
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 7.85e-75
Family Formin homology 2 domain (FH2 domain) 0.0000343
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000040669   Gene: ENSMODG00000027399   Transcript: ENSMODT00000043776
Sequence length 615
Comment pep:novel chromosome:BROADO5:1:488289298:488350364:1 gene:ENSMODG00000027399 transcript:ENSMODT00000043776 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHLLNKVLWKSMESPLGQTAQHDGAVHEGLLELEQSGLEAAKWVKCLVQLHKRQLTLYPL
GFHEENEKNDLEANIVELLDVKVHKENEHDEFSVQAKEDIYLFRIPASSLSRPMEDVIEM
RDRWVTLINQYCTHSLTHSDHQSEFQDGSSCVETSLTSKHKINKDGTDIFPEGKERELVS
LLASASSMTSLSMVPTSCCESESQRRTSVGQDMASVPQPCLSVVKGGLSPPASLPATNSI
PATERTKAFHWDIVPHDKIQKSIWATCDLQKRKIDVTRLYDQFHTLNTPVMLNNDLLGKQ
HLLLDHKVAHNFSIFLRHFHFKPKELQGRLYVLQEETGGLAYEHIITLRRYVPTIKDIEM
YQSYQGSPSELHLVDQFMLEMCKIPHLGQRLELLLMIREFPGYVKDLQPLLNQKIQACQQ
LKASQMFVAILEYLLAIGNYLNEKAGKEKARGFRLSSLSKLSLLRGKEKKFTLVHALAEQ
ILLHQPHLAKFPQELTEFEAAPGASIKGLNAEVDVLKKELEKIIQYKKILKPKNLRPSEQ
ESQFHQDLKDLIQKYEGDLSQLSKRCDEMKKLYGDILEQFGERPDQDSQELFGWISTFVR
EFRKAQADLDLQVSK
Download sequence
Identical sequences K7E4G7
ENSMODP00000040669 ENSMODP00000040669

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]